KEGG   Brachyspira pilosicoli 95/1000: BP951000_2283Help
Entry
BP951000_2283     CDS       T01278                                 

Gene name
gmk
Definition
guanylate kinase
Orthology
K00942  
guanylate kinase [EC:2.7.4.8]
Organism
bpo  Brachyspira pilosicoli 95/1000
Pathway
Purine metabolism
Metabolic pathways
Module
Guanine ribonucleotide biosynthesis IMP => GDP,GTP
Class
Metabolism; Nucleotide metabolism; Purine metabolism [PATH:bpo00230]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(2519523..2520074)
Genome map
AA seq 183 aa AA seqDB search
MSNIVVITAPSAAGKTTLIKKYMSKHSNAMFSVSHTTRNIREGEVDGKDYYFIDKDTFQK
MIDNGDFIEWANVHDNYYGTSFKELEKANNEKVILILDIDIQGALFLKEKGIHANYIFIE
PPSIDDLKARLEARGTESEESMKIRIQNAKRELEYKNKFDIVIKNDEIDVAYRQLEEAIN
SKL
NT seq 552 nt NT seq  +upstreamnt  +downstreamnt
atgagtaatatagtggtaataacagctccatcggcagctggtaaaacaactttaataaaa
aaatatatgtcaaaacactcaaatgcaatgttcagtgtgtctcatacaactagaaatatt
agagaaggtgaagttgacggcaaagattactactttatagataaagatactttccaaaaa
atgatagataatggcgattttattgaatgggctaatgttcatgataattattacggcact
tcttttaaagaattagaaaaggctaataatgaaaaagttatattaatattggatatagat
atacaaggagcattatttttaaaagaaaaaggaatacatgctaactatatatttatagag
cctccttcaatagatgatttgaaagcaagattagaggcaagaggaactgaatctgaagaa
agcatgaagattagaatacaaaatgctaaaagagaattggaatataaaaataaatttgat
attgttataaaaaatgatgaaattgatgtagcttataggcaattagaagaagctataaat
tcaaaattataa

DBGET integrated database retrieval system