KEGG   Brachyspira pilosicoli 95/1000: BP951000_2325Help
Entry
BP951000_2325     CDS       T01278                                 

Gene name
trpB
Definition
(GenBank) tryptophan synthase subunit beta
  KO
K01696  tryptophan synthase beta chain [EC:4.2.1.20]
Organism
bpo  Brachyspira pilosicoli 95/1000
Pathway
bpo00260  Glycine, serine and threonine metabolism
bpo00400  Phenylalanine, tyrosine and tryptophan biosynthesis
bpo01100  Metabolic pathways
bpo01110  Biosynthesis of secondary metabolites
bpo01130  Biosynthesis of antibiotics
bpo01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:bpo00001]
 Metabolism
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    BP951000_2325 (trpB)
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    BP951000_2325 (trpB)
Enzymes [BR:bpo01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     BP951000_2325 (trpB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PALP
Motif
Other DBs
NCBI-ProteinID: ADK32297
UniProt: D8IAG7
Position
2568415..2569671
Genome map
AA seq 418 aa AA seqDB search
MITSENGFFGEFGGRFVDEKLEKKLIELEEAFKFYIKDKDFLNELEELRSDFLGRPTPLM
YAKNISESIGGAKIYVKLEGFAHTGAHKINNSIGQALLAKRMGKKKIIAETGAGQHGIAT
AAACAKLGLECSIYMGDIDVRRQQPNVASMELYGANVVSVKRGSRGLKDAVDAALEEWIK
DLDDTHYLLGSAVGPSPYPDIVRTFQSIIGRELEKQIAEKNLKVKSMFACVGGGSNAIGF
FEPFIEKTDIELVAIEAGGIGSNIGENAVRMNNQYAKDHVAQGYKSKFILKENGEISDTM
SISAGLDYPGIGPQLAYLGDIGRIKFLSATDMEAINAVKEFAKHEGVIFALESAHAGAKA
IEYAKKCSKDDVIIVNMSGRGDKDIFITSPIFRAKRWKEFLQDELNRLENNIDIHNFK
NT seq 1257 nt NT seq  +upstreamnt  +downstreamnt
atgataacaagtgaaaacggtttttttggtgagtttggaggaagatttgtagatgagaaa
cttgaaaagaaattaatagaattagaagaggcttttaaattttatataaaagataaagat
tttttaaatgagctagaagagcttagaagcgattttttgggaagacctacaccattaatg
tatgctaaaaatatatctgagagtataggcggtgctaaaatatatgtaaaattagaaggt
tttgcccatactggtgcacataaaattaataactctataggtcaggcattattggcaaag
agaatgggaaagaaaaaaataatagcagaaacaggagcaggtcagcatggtattgctact
gcggctgcttgtgctaagttgggattagaatgttctatatatatgggggatatagatgta
cgcaggcaacagcctaatgtggcatctatggaattatatggggctaatgttgtatctgtt
aaaagaggttctagaggattaaaagatgcagttgatgcggctttagaagaatggataaaa
gatttagatgatactcattatttacttggaagtgctgttggacctagtccttatcctgat
atagttagaactttccaatctataataggaagagaattagaaaaacaaatagcagaaaaa
aacttaaaagtaaaatctatgtttgcatgtgttggaggcggttctaatgcaataggtttt
tttgagccttttatagaaaaaactgatatagaattggtagctattgaagctggtggaata
ggttcaaatattggagagaatgctgtaagaatgaataatcaatatgctaaagaccatgta
gctcaggggtataagagtaagtttatattaaaagaaaatggagagatatctgatactatg
tctatatcagcaggacttgattatcctggaattggacctcaattagcatatttaggagat
attggaagaattaaatttttaagtgctacagatatggaagctattaatgctgttaaagaa
tttgctaaacatgagggagttatatttgctttagagagtgctcatgctggtgctaaggct
attgaatatgctaaaaaatgctctaaagatgatgttataatagttaatatgtctggaagg
ggagataaagatatttttataacttctccaatatttagagctaagagatggaaagagttt
ttacaagatgaattaaatagattagaaaataatattgatatacataattttaaataa

DBGET integrated database retrieval system