KEGG   Brucella pinnipedialis: BPI_I1516Help
Entry
BPI_I1516         CDS       T01589                                 

Gene name
pncA
Definition
pyrazinamidase / nicotinamidase (EC:3.5.1.- 3.5.1.19)
Orthology
K08281  
nicotinamidase/pyrazinamidase [EC:3.5.1.19 3.5.1.-]
Organism
bpp  Brucella pinnipedialis
Pathway
Nicotinate and nicotinamide metabolism
Metabolic pathways
Class
Metabolism; Metabolism of cofactors and vitamins; Nicotinate and nicotinamide metabolism [PATH:bpp00760]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1:1451553..1452182
Genome map
AA seq 209 aa AA seqDB search
MIGHALVVIDVQNDFCPGGALAVERGDEIIPIVNRLIGESENVVVTQDWHPANHSSFASN
HPGSRPFDTVNMSYGPQVLWPDHCVQNSEGAEFHPDLQWWRAQLVVRKGFRIGIDSYSAF
FENDHCTPTGLGGYLRERNIGSLTTVGLATDFCVASSALDAVQQGFQVRVRLDACRGIDL
NGSMNIMLEKMKQAGVELIDEPVSASHLL
NT seq 630 nt NT seq  +upstreamnt  +downstreamnt
atgatcggccatgcacttgtggttatcgacgtccagaatgatttttgccccggcggcgcc
ttggccgtcgaacgtggcgatgaaatcatcccgatcgtcaaccgcctgatcggggaaagc
gaaaatgtcgtggtcacgcaggattggcatccggccaaccattccagcttcgcctccaac
caccccggcagccgcccgttcgatacggtcaatatgtcttatgggccgcaggtgctctgg
ccggatcattgcgtgcaaaatagcgagggggcagaatttcaccccgatctgcaatggtgg
cgtgcacagcttgtcgtccgcaagggtttccgcattggtatcgacagctactccgcattt
tttgaaaatgaccattgcacgccgacgggccttggcggatatttgcgtgaacgcaatatc
ggatcattgacaacggttggcctcgccaccgatttctgcgtcgccagttcagcgcttgat
gcggtccagcagggctttcaggtgcgggtgcgactcgatgcctgccgcggtattgatctc
aacgggtcgatgaacatcatgctggagaaaatgaaacaggctggcgtcgaactgatcgat
gagcctgtttcagcgtcgcatctactctag

DBGET integrated database retrieval system