KEGG   Brucella pinnipedialis: BPI_I2016Help
Entry
BPI_I2016         CDS       T01589                                 

Definition
arginase family protein
Orthology
K01480  
agmatinase [EC:3.5.3.11]
Organism
bpp  Brucella pinnipedialis
Pathway
Arginine and proline metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:bpp00001]
 Metabolism
  Amino acid metabolism
   00330 Arginine and proline metabolism
    BPI_I2016
Enzymes [BR:bpp01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.3  In linear amidines
    3.5.3.11  agmatinase
     BPI_I2016
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1:1917515..1918528
Genome map
AA seq 337 aa AA seqDB search
MTDKLTSAPKHGHTSMLYSKVHTDLDTLDAHIAFLGIPYGSAYTIDEVTNDQTRAPTAVR
QATDRAVRNLDRYDFDVDGPLYDGRAIKAVDCGDVVGDPKDPGAHYRNAEAAVRKILAAG
ALPLIIGGDHGIPIPVLRAYDDQGPITLIQIDAHLDWRDHINGVHDGLSSPIRRASEMAH
VKDIFQIGIRAQGTARPEEYEAARAYGSNIITAYELHDVGMDAILDRIPDGGRYYITIDA
DGIDPSVMPAVAGPAFGGVTYAQTRKLLHGLVKKGRVVGMDIVEITPSKDVNQLTAIAAG
RFFVNLIGAAVRADYFGTKAELETAAGKTMKPAHAAA
NT seq 1014 nt NT seq  +upstreamnt  +downstreamnt
atgaccgacaagcttacctccgcgccaaagcatggacatacgagcatgctttattccaag
gttcacacggatctcgacacgctcgacgcccacatcgcctttcttggtattccttacggc
tctgcctatacgatcgatgaagtcaccaacgaccagacgcgggcgccgacagcagtgcgc
caggcgaccgaccgtgccgtccgcaacctcgaccggtatgacttcgacgtcgatggccct
ctctacgatggccgtgccatcaaggcggtcgattgcggcgatgtggtgggcgaccccaag
gaccctggcgcacattaccgcaatgcggaagcagccgttcgcaagattctcgccgccggc
gccctgcccctcatcatcgggggcgatcacggcatcccgatcccggtcctgcgcgcctat
gacgatcaggggccgatcaccctgatccagatcgacgcccatctggactggcgtgatcac
atcaatggtgtgcatgacggcctttcaagcccgatccgccgcgcttcggaaatggcgcat
gtcaaggatatcttccagatcggcatccgcgcccagggcacggcacgccccgaagaatat
gaggccgcgagagcttacggctccaatatcatcacagcttacgaattgcatgatgtcggc
atggacgccattctcgatcgtattcccgatggcgggcgctattacatcaccatcgatgcc
gacgggatcgatccttccgtcatgcctgcggtggctggtcccgcctttggcggtgtgacc
tatgcccagacgcgcaaactcctgcatggccttgtcaagaaggggcgcgtcgtcggcatg
gatatcgtggagattacgccttccaaggatgtaaaccagcttaccgcgatcgccgccgga
cgtttcttcgtcaacctgattggtgctgccgtgcgcgccgactatttcggcacgaaagca
gagcttgaaacggccgctggcaaaaccatgaaaccggcccacgccgcagcctga

DBGET integrated database retrieval system