KEGG   Brucella pinnipedialis B2/94: BPI_I2241Help
Entry
BPI_I2241         CDS       T01589                                 

Definition
(GenBank) enoyl-CoA hydratase
  KO
K01692  enoyl-CoA hydratase [EC:4.2.1.17]
Organism
bpp  Brucella pinnipedialis B2/94
Pathway
bpp00071  Fatty acid degradation
bpp00280  Valine, leucine and isoleucine degradation
bpp00281  Geraniol degradation
bpp00310  Lysine degradation
bpp00360  Phenylalanine metabolism
bpp00362  Benzoate degradation
bpp00380  Tryptophan metabolism
bpp00410  beta-Alanine metabolism
bpp00627  Aminobenzoate degradation
bpp00640  Propanoate metabolism
bpp00650  Butanoate metabolism
bpp00903  Limonene and pinene degradation
bpp00930  Caprolactam degradation
bpp01100  Metabolic pathways
bpp01110  Biosynthesis of secondary metabolites
bpp01120  Microbial metabolism in diverse environments
bpp01130  Biosynthesis of antibiotics
bpp01212  Fatty acid metabolism
Module
bpp_M00087  beta-Oxidation
Brite
KEGG Orthology (KO) [BR:bpp00001]
 Metabolism
  Carbohydrate metabolism
   00640 Propanoate metabolism
    BPI_I2241
   00650 Butanoate metabolism
    BPI_I2241
  Lipid metabolism
   00071 Fatty acid degradation
    BPI_I2241
  Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    BPI_I2241
   00310 Lysine degradation
    BPI_I2241
   00360 Phenylalanine metabolism
    BPI_I2241
   00380 Tryptophan metabolism
    BPI_I2241
  Metabolism of other amino acids
   00410 beta-Alanine metabolism
    BPI_I2241
  Metabolism of terpenoids and polyketides
   00903 Limonene and pinene degradation
    BPI_I2241
   00281 Geraniol degradation
    BPI_I2241
  Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    BPI_I2241
   00627 Aminobenzoate degradation
    BPI_I2241
   00930 Caprolactam degradation
    BPI_I2241
Enzymes [BR:bpp01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.17  enoyl-CoA hydratase
     BPI_I2241
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ECH_1 ECH_2 Peptidase_S49
Motif
Other DBs
NCBI-ProteinID: AEK55462
Position
1:2136761..2137534
Genome map
AA seq 257 aa AA seqDB search
MAYETIIVETRDSVGLIRLNRPQALNALNRAVLEELTDALAAFDADGKVGAVVLTGSEKA
FAAGADIKEMQSINFVDAYLQDMFADWQKVDRIRKPIIAAVSGYALGGGCELAMMCDFII
AGSNAKFGQPEITLGVIPGMGGSQRLTRYVGKSKAMDMCLTGRMMDAAEAERCGLVSRVV
APEALLEEALKAAERIASFSRVSVYMAKEAVNRAYETTLDEGLRFERRLFHSLFATEDQK
EGMSAFVDKRTPSFKNR
NT seq 774 nt NT seq  +upstreamnt  +downstreamnt
atggcctatgaaacaatcatcgttgagacgcgtgacagcgttggtctcatccgtctcaac
cgtccgcaggcgctcaacgcgctcaatcgcgccgtgcttgaggagctgaccgatgcgctt
gccgccttcgacgcggatggcaaggtcggcgccgtggtgctgaccggctcggaaaaggct
ttcgccgccggggccgacatcaaggaaatgcagtcgatcaatttcgtcgatgcctatttg
caggacatgttcgccgactggcagaaggtggatcgtatccgcaagccgattatcgcggct
gtttcgggctatgcgctgggcggcggctgcgaactcgccatgatgtgcgatttcatcatc
gcgggcagcaatgcgaaattcggccagccggaaatcacgctgggcgtcattcctggcatg
ggcggctcgcagcgcctgacgcgctatgtcggcaagtccaaggctatggatatgtgcctg
acgggccgcatgatggatgcagccgaagcggagcgttgcggccttgtttcccgcgttgtc
gcaccggaggctcttctggaagaggcactgaaagcagccgaacgcatcgcatccttctcg
cgcgtctcggtctatatggccaaggaagcggtcaaccgcgcctatgaaacgacgctggac
gagggcctgcgtttcgagcgccgcctgttccattcgcttttcgcgaccgaagaccagaag
gaaggcatgtccgctttcgttgataaacgtaccccttccttcaagaaccgctga

DBGET integrated database retrieval system