KEGG   Brucella pinnipedialis B2/94: BPI_I467Help
Entry
BPI_I467          CDS       T01589                                 

Gene name
tlyA
Definition
(GenBank) hemolysin A
  KO
K06442  
23S rRNA (cytidine1920-2'-O)/16S rRNA (cytidine1409-2'-O)-methyltransferase [EC:2.1.1.226 2.1.1.227]
Organism
bpp  Brucella pinnipedialis B2/94
Brite
Enzymes [BR:bpp01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.226  23S rRNA (cytidine1920-2'-O)-methyltransferase
     BPI_I467 (tlyA)
    2.1.1.227  16S rRNA (cytidine1409-2'-O)-methyltransferase
     BPI_I467 (tlyA)
Ribosome biogenesis [BR:bpp03009]
 Prokaryotic Type
  rRNA modification factors
   16S rRNA modification factors
    BPI_I467 (tlyA)
   23S rRNA modification factors
    BPI_I467 (tlyA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
Position
1:458256..459017
Genome map
AA seq 253 aa AA seqDB search
MNGQSTDNRPRLDQLLVERGFFATRSRARDAIQRGTVKVDGRPITKPGQMVVRDAALAVD
DPASAYVSRAALKLVAALDHFDLNVKGRTALDIGASTGGFTQVLLERGAHHVIAIDVGHD
QLHESLRHDPRVTSKEGVNARALELAHLDTRAVDCIVSDVSFISLRLALPPALALAEKGA
ICALLVKPQFEAGREAIGKGGILRDPAYGERMAQELKSWLETQPGWRALGLCPSPIEGGD
GNREYLLAGKKDR
NT seq 762 nt NT seq  +upstreamnt  +downstreamnt
atgaacggccagtccaccgataaccgtccgcgccttgaccagcttttggttgagcgcgga
tttttcgcgacacgctcgcgcgcccgtgacgctatccagcgcggcacggtgaaggtggat
ggcaggcccatcaccaagcccggccagatggtggttcgcgacgccgcacttgcggtggac
gatccggcaagcgcctatgtctcgcgcgccgcattgaagcttgttgccgcgcttgaccat
ttcgacctcaatgtgaagggccggaccgcgctcgatatcggtgcttccaccggcggtttt
acgcaagtgctgctggagcggggcgcgcatcatgtcatcgccatcgatgttggccatgac
cagttgcatgaaagcttgcgccacgatccgcgcgtgaccagcaaggagggtgtcaatgcc
cgcgcgctggagcttgcgcatctggacacgcgcgctgtcgattgtattgtgtcggatgtc
agcttcatctcgctcaggctggcgctgcccccggcattggctctggctgaaaaaggtgct
atctgcgcgcttctcgtcaaaccgcaattcgaggcgggacgcgaagcgatcggcaagggc
ggcatcttgcgcgatcccgcatatggcgagcgcatggcgcaagaactgaaatcatggctg
gaaacgcagcccggctggcgtgctctcggcctttgtccgtcgcccatcgaaggcggcgac
ggcaatcgtgaatatcttctggcaggaaagaaggacagatga

DBGET integrated database retrieval system