KEGG   Brucella pinnipedialis: BPI_I467Help
Entry
BPI_I467          CDS       T01589                                 

Gene name
tlyA
Definition
hemolysin A
Orthology
K06442  
23S rRNA (cytidine1920-2'-O)/16S rRNA (cytidine1409-2'-O)-methyltransferase [EC:2.1.1.226 2.1.1.227]
Organism
bpp  Brucella pinnipedialis
Class
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1:458256..459017
Genome map
AA seq 253 aa AA seqDB search
MNGQSTDNRPRLDQLLVERGFFATRSRARDAIQRGTVKVDGRPITKPGQMVVRDAALAVD
DPASAYVSRAALKLVAALDHFDLNVKGRTALDIGASTGGFTQVLLERGAHHVIAIDVGHD
QLHESLRHDPRVTSKEGVNARALELAHLDTRAVDCIVSDVSFISLRLALPPALALAEKGA
ICALLVKPQFEAGREAIGKGGILRDPAYGERMAQELKSWLETQPGWRALGLCPSPIEGGD
GNREYLLAGKKDR
NT seq 762 nt NT seq  +upstreamnt  +downstreamnt
atgaacggccagtccaccgataaccgtccgcgccttgaccagcttttggttgagcgcgga
tttttcgcgacacgctcgcgcgcccgtgacgctatccagcgcggcacggtgaaggtggat
ggcaggcccatcaccaagcccggccagatggtggttcgcgacgccgcacttgcggtggac
gatccggcaagcgcctatgtctcgcgcgccgcattgaagcttgttgccgcgcttgaccat
ttcgacctcaatgtgaagggccggaccgcgctcgatatcggtgcttccaccggcggtttt
acgcaagtgctgctggagcggggcgcgcatcatgtcatcgccatcgatgttggccatgac
cagttgcatgaaagcttgcgccacgatccgcgcgtgaccagcaaggagggtgtcaatgcc
cgcgcgctggagcttgcgcatctggacacgcgcgctgtcgattgtattgtgtcggatgtc
agcttcatctcgctcaggctggcgctgcccccggcattggctctggctgaaaaaggtgct
atctgcgcgcttctcgtcaaaccgcaattcgaggcgggacgcgaagcgatcggcaagggc
ggcatcttgcgcgatcccgcatatggcgagcgcatggcgcaagaactgaaatcatggctg
gaaacgcagcccggctggcgtgctctcggcctttgtccgtcgcccatcgaaggcggcgac
ggcaatcgtgaatatcttctggcaggaaagaaggacagatga

DBGET integrated database retrieval system