KEGG   Brucella pinnipedialis: BPI_I86Help
Entry
BPI_I86           CDS       T01589                                 

Definition
lipase/acylhydrolase domain-containing protein
Orthology
K10804  
acyl-CoA thioesterase I [EC:3.1.2.- 3.1.1.5]
Organism
bpp  Brucella pinnipedialis
Pathway
Biosynthesis of unsaturated fatty acids
Brite
KEGG Orthology (KO) [BR:bpp00001]
 Metabolism
  Lipid metabolism
   01040 Biosynthesis of unsaturated fatty acids
    BPI_I86
Enzymes [BR:bpp01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.5  lysophospholipase
     BPI_I86
   3.1.2  Thioester hydrolases
    3.1.2.-  
     BPI_I86
Lipid biosynthesis proteins [BR:bpp01004]
 Fatty acid synthase
  Component type
   BPI_I86
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1:complement(89578..90303)
Genome map
AA seq 241 aa AA seqDB search
MMRFKLQIPAAAMLKALLVSLLALFVAAASASAQEEPTGLEDALPTEQLSQVKIVGFGDS
LMAGYLLPSNAAFPQQLEKALNDKGYEVTVENAGVSGDTTTGGLSRIDWSIPDGTNLVIL
ELGANDALRGIQPDITEKNLDEMLAKLKARGISVILAGMVAPPNMGKDYAGKFNPIYPRL
ARKYDVPLYPFFLDGVATRKGLLLEDGMHPNEKGVETIVANFMPSVEKALKNLQNTGTSG
G
NT seq 726 nt NT seq  +upstreamnt  +downstreamnt
atgatgcgtttcaaactccaaattcccgcagccgcgatgctcaaggcgcttctggtttcg
cttttggcactttttgtcgcggccgcaagtgcaagcgcgcaagaagaaccgacaggcctt
gaagatgcgctgcccaccgaacagctctcgcaggtgaagatcgtgggcttcggcgacagc
ctcatggctggctatcttctgccgtcgaatgccgcctttccacagcagcttgaaaaggcg
ctcaacgacaagggctacgaggtgacggtcgaaaatgcgggcgtatcgggcgacaccacg
accggcgggctttcgcgtatcgactggtccattcccgatggtaccaatctggtgatcctg
gaacttggcgcaaacgatgcgctgcgcggcatccagccggatatcacggaaaagaatctc
gatgaaatgctggcaaagctgaaggcgcgcggcatttccgtcatccttgcaggcatggtt
gcccctcccaatatgggaaaagactatgcaggcaaattcaacccgatctatcccaggctg
gcgcgcaaatatgatgtgccgctctacccgttcttcctcgacggtgtagcaaccaggaaa
ggacttttgctcgaggacggaatgcatcccaatgaaaagggtgtcgaaacgatcgtggcc
aatttcatgccgtcggtcgaaaaggcgctcaagaatttgcaaaacacggggacatcgggc
ggatga

DBGET integrated database retrieval system