KEGG   Brucella pinnipedialis: BPI_I86Help
Entry
BPI_I86           CDS       T01589                                 

Definition
lipase/acylhydrolase domain-containing protein
Orthology
K10804  
acyl-CoA thioesterase I [EC:3.1.2.- 3.1.1.5]
Organism
bpp  Brucella pinnipedialis
Pathway
Biosynthesis of unsaturated fatty acids
Class
Metabolism; Lipid metabolism; Biosynthesis of unsaturated fatty acids [PATH:bpp01040]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1:complement(89578..90303)
Genome map
AA seq 241 aa AA seqDB search
MMRFKLQIPAAAMLKALLVSLLALFVAAASASAQEEPTGLEDALPTEQLSQVKIVGFGDS
LMAGYLLPSNAAFPQQLEKALNDKGYEVTVENAGVSGDTTTGGLSRIDWSIPDGTNLVIL
ELGANDALRGIQPDITEKNLDEMLAKLKARGISVILAGMVAPPNMGKDYAGKFNPIYPRL
ARKYDVPLYPFFLDGVATRKGLLLEDGMHPNEKGVETIVANFMPSVEKALKNLQNTGTSG
G
NT seq 726 nt NT seq  +upstreamnt  +downstreamnt
atgatgcgtttcaaactccaaattcccgcagccgcgatgctcaaggcgcttctggtttcg
cttttggcactttttgtcgcggccgcaagtgcaagcgcgcaagaagaaccgacaggcctt
gaagatgcgctgcccaccgaacagctctcgcaggtgaagatcgtgggcttcggcgacagc
ctcatggctggctatcttctgccgtcgaatgccgcctttccacagcagcttgaaaaggcg
ctcaacgacaagggctacgaggtgacggtcgaaaatgcgggcgtatcgggcgacaccacg
accggcgggctttcgcgtatcgactggtccattcccgatggtaccaatctggtgatcctg
gaacttggcgcaaacgatgcgctgcgcggcatccagccggatatcacggaaaagaatctc
gatgaaatgctggcaaagctgaaggcgcgcggcatttccgtcatccttgcaggcatggtt
gcccctcccaatatgggaaaagactatgcaggcaaattcaacccgatctatcccaggctg
gcgcgcaaatatgatgtgccgctctacccgttcttcctcgacggtgtagcaaccaggaaa
ggacttttgctcgaggacggaatgcatcccaatgaaaagggtgtcgaaacgatcgtggcc
aatttcatgccgtcggtcgaaaaggcgctcaagaatttgcaaaacacggggacatcgggc
ggatga

DBGET integrated database retrieval system