KEGG   Brucella pinnipedialis: BPI_I915Help
Entry
BPI_I915          CDS       T01589                                 

Definition
beta-hexosaminidase A (EC:3.2.1.52)
Orthology
K01207  
beta-N-acetylhexosaminidase [EC:3.2.1.52]
Organism
bpp  Brucella pinnipedialis
Pathway
beta-Lactam resistance
Amino sugar and nucleotide sugar metabolism
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:bpp00001]
 Metabolism
  Carbohydrate metabolism
   00520 Amino sugar and nucleotide sugar metabolism
    BPI_I915
 Human Diseases
  Drug resistance
   00312 beta-Lactam resistance
    BPI_I915
Enzymes [BR:bpp01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.52  beta-N-acetylhexosaminidase
     BPI_I915
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1:880694..881746
Genome map
AA seq 350 aa AA seqDB search
MIQQDNSRKSRMKECKAWIAGISGTKLTPDEIAFFRDETPWGFILFARNVESLEQVSELT
AHLRDLTGLDQTPVFIDQEGGRVQRLRPPLVPNYPSASEIGAIYARDKEKGLRAAWLHAR
LHAFDLLKVGVNADCLPVLDVPVEGAHDVIGMRAYSKNPHAVAEMGRAAAEGLLAGGVLP
VVKHMPGHGRAFSDTHKELARVSVALNELVAHDFVPFKALNDLPMAMTAHVVFDCIDPER
PSTLSPTVINTIIRDVIGFDGLVISDDISMKALSGDLGDITDGIVTAGCDIVLYCSGVME
ELVKVAARVPVLDGKAKRRAELAEVYAGDPDLSDEDEVRAEFNAMFEPIA
NT seq 1053 nt NT seq  +upstreamnt  +downstreamnt
ttgattcagcaagacaattcgaggaaaagccgcatgaaagagtgcaaggcatggattgcc
ggtatatccggcacgaagctcaccccggacgagattgccttcttccgggatgaaaccccg
tggggcttcattctttttgctcgcaatgtggaaagcctcgaacaggtgagcgagctcacc
gcccatctgcgtgacctgacggggctggaccagacgccggttttcatcgatcaggagggc
gggcgcgtgcagcgccttcgcccgccgctggtaccgaactatccgtccgcgtccgaaatt
ggcgcgatctatgcacgcgacaaggaaaaggggttgcgtgccgcctggctccatgcccgg
ctccatgctttcgatctgttgaaggtcggcgtcaatgcggattgcctgccggttctggat
gtgccggtggagggcgcgcatgatgtgatcggaatgcgggcctattccaaaaacccccat
gcggttgcggaaatgggacgcgctgccgccgaaggtcttctggctggcggcgttcttccc
gtcgtgaagcatatgccgggccatggccgcgccttttccgatacgcataaggaactggcg
cgggtcagcgttgcgctcaacgaactggttgcgcatgatttcgtgccgttcaaggcgctc
aatgatctgccgatggccatgaccgcccatgtggtgttcgattgcatcgacccggaaaga
ccgtccacgctttcgccgacggttattaatacgatcattcgcgatgtgatcgggttcgac
ggccttgtcatcagtgacgacatttccatgaaggcattgtccggcgatcttggcgatata
accgacggcatcgttacggcgggctgcgatatcgtgctctattgctcaggcgttatggag
gaactggtaaaggttgccgcccgtgtgccggttctggatggcaaagcaaagcgccgggcc
gaactggcggaagtctatgcgggcgaccccgatctttccgacgaggacgaggtgcgcgcc
gaattcaatgccatgtttgaaccgatagcgtaa

DBGET integrated database retrieval system