KEGG   Brucella pinnipedialis: BPI_I923Help
Entry
BPI_I923          CDS       T01589                                 

Gene name
pcm
Definition
protein-L-isoaspartate O-methyltransferase
Orthology
K00573  
protein-L-isoaspartate(D-aspartate) O-methyltransferase [EC:2.1.1.77]
Organism
bpp  Brucella pinnipedialis
Class
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1:887542..888141
Genome map
AA seq 199 aa AA seqDB search
MRGHSIDDPQLFAAIEATPRQSFLAAAWSHLAYSPRTAPLDCGEYMEGIDDQARVISALK
LEPGHRVLEIGTGSGFTAAVMSLLSGRVTTVERYRKLCDHALQQFVSLKRENIMVKHTDG
RHGMPGGPFDRIVIWLACDEVPRHFVELLATHGVLIAPIGPGDGRQIMTRISKVGSRFEQ
EDLMPVRYQPFIEGTSSVL
NT seq 600 nt NT seq  +upstreamnt  +downstreamnt
atgcgtgggcacagcattgatgatccgcaactttttgcggcaattgaagcaacgccgcgc
cagagctttctggcggcggcatggtcgcatcttgcctatagcccgcgaaccgcgccgctt
gattgcggtgaatatatggaaggcatagacgatcaggcgcgcgtcatttccgccctgaag
cttgagcccggccatcgggttctggaaatcggcaccggctccggctttaccgccgccgtt
atgtccttgctgtccggccgtgtaacgacggtggaacggtatcgaaaactctgcgaccac
gctctccagcagttcgtttcgctgaagcgcgagaatatcatggtgaaacatacagacggg
cgccacggtatgccgggcgggccgtttgaccgcattgtcatctggctcgcatgcgatgag
gtgccgcgccatttcgttgaactgctcgccacccatggcgtcctgatagccccgatcggc
cctggcgatggacgccagatcatgacgcggatttcaaaggttggaagccgttttgaacag
gaagacctcatgccggttcgatatcagccgttcatcgaaggcacgtcttccgttctttag

DBGET integrated database retrieval system