KEGG   Brucella pinnipedialis B2/94: BPI_II1105Help
Entry
BPI_II1105        CDS       T01589                                 

Gene name
glk
Definition
(GenBank) glucokinase
  KO
K00845  glucokinase [EC:2.7.1.2]
Organism
bpp  Brucella pinnipedialis B2/94
Pathway
bpp00010  Glycolysis / Gluconeogenesis
bpp00052  Galactose metabolism
bpp00500  Starch and sucrose metabolism
bpp00520  Amino sugar and nucleotide sugar metabolism
bpp00521  Streptomycin biosynthesis
bpp01100  Metabolic pathways
bpp01110  Biosynthesis of secondary metabolites
bpp01120  Microbial metabolism in diverse environments
bpp01130  Biosynthesis of antibiotics
bpp01200  Carbon metabolism
Module
bpp_M00549  Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:bpp00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    BPI_II1105 (glk)
   00052 Galactose metabolism
    BPI_II1105 (glk)
   00500 Starch and sucrose metabolism
    BPI_II1105 (glk)
   00520 Amino sugar and nucleotide sugar metabolism
    BPI_II1105 (glk)
  Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    BPI_II1105 (glk)
   00524 Neomycin, kanamycin and gentamicin biosynthesis
    BPI_II1105 (glk)
Enzymes [BR:bpp01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.2  glucokinase
     BPI_II1105 (glk)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Glucokinase ROK
Motif
Other DBs
NCBI-ProteinID: AEK56507
Position
2:1089549..1090580
Genome map
AA seq 343 aa AA seqDB search
MQAIIDAEQSFKFPVLVGDIGGTNARFSILVDSNAEPKEFPVLQTADYATIDEAIQHAIL
DQTAIQPRSVILAVAGPVDGDEIDLTNCDWVVRPKKMIADLGFEDVTVLNDFEAQALAVV
SLEGHHMEQIGGKPEEAVATRVVLGPGTGLGVAGLVRTRHAWVPVPGEGGHIDIGPRTER
DYQIFPHIERIEGRVTGEQILSGRGLRNLYLGICAADKITPTLETPVDITSAGLDGSNPQ
AAETLDLFATYLGRLAGDLALIFMAHGGVYLSGGIPVRILSALKAGSFRAAFEDKAPHKA
IMRDIPVRVITYQLAALTGLSAFARTPSRFEVSTEGRRWRMRR
NT seq 1032 nt NT seq  +upstreamnt  +downstreamnt
atgcaagcgattatcgacgccgaacagagtttcaagtttccggttctcgtcggcgatatc
ggcggcaccaatgcccgtttttctatcctcgtggattcaaacgcggagccgaaggagttt
cccgtgctccagacggcggattatgccacaatagacgaagcgatccagcacgccattctg
gatcagacggccatccagccgcgctctgtcattctggccgtggcaggcccggtggacggc
gacgagatcgacctcaccaattgcgactgggtcgtgcgtcctaaaaagatgatcgctgat
ctgggctttgaagacgtgaccgtcctcaatgatttcgaggcgcaggcccttgccgtggtt
tcgctggaaggccaccatatggaacagatcggcggcaaaccggaggaggctgttgccacc
cgcgtcgtgctcggccccggcacgggccttggcgtggcaggtctggttcgcacacgtcat
gcatgggttccggttcccggtgaaggcggtcatatcgatatcggtccacgcaccgaacgc
gactaccagattttcccgcatatcgaacgcatcgaagggcgtgtcaccggcgagcaaatt
cttagcgggcggggcctgcgcaacctctatctgggcatctgcgccgccgacaagatcacg
cccacccttgagacgccagtagacattacatccgccggactggacggcagcaatccacaa
gccgcagaaacgcttgacctcttcgccacctatctggggcggcttgcgggcgaccttgcg
ctcattttcatggcgcatggcggcgtttatctttcgggtggcatcccggtgcgcatcctt
tccgccctcaaggccggttcgttccgcgcagccttcgaggacaaggccccgcacaaagcc
atcatgcgcgacataccggtccgcgttatcacatatcaactggcggccttaaccgggctt
tccgctttcgcccgcaccccctcgcgctttgaagtttcgaccgagggccgccgctggcgc
atgcgccgctag

DBGET integrated database retrieval system