KEGG   Brucella pinnipedialis: BPI_II339Help
Entry
BPI_II339         CDS       T01589                                 

Definition
glutaminase
Orthology
K01425  
glutaminase [EC:3.5.1.2]
Organism
bpp  Brucella pinnipedialis
Pathway
Alanine, aspartate and glutamate metabolism
Arginine and proline metabolism
D-Glutamine and D-glutamate metabolism
Metabolic pathways
Class
Metabolism; Amino acid metabolism; Alanine, aspartate and glutamate metabolism [PATH:bpp00250]
Metabolism; Amino acid metabolism; Arginine and proline metabolism [PATH:bpp00330]
Metabolism; Metabolism of other amino acids; D-Glutamine and D-glutamate metabolism [PATH:bpp00471]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2:323415..324368
Genome map
AA seq 317 aa AA seqDB search
MSSSSDAIKAALEKGRAAGLSATGGKNADYIPFLASVPSDLFGLAVVTADGQTFKTGDAD
FAFAIESISKVFTLALVMEEIGPDSVREKVGADPTGLPFNSVIALELHNGKSLSPLVNAG
AIATASLVPGDTADARWNNILECQCGFAGRRLKLSNEVNQSEQTTNFHNRAIAWLLYSAG
TCYSDPMEAVDIYTRQCSTLVTATDLATMGATLAAGGVNPISGKRMVSAGNVAPILAEMT
MEGLYTASGDWAYTVGLPGKSGVGGGIMAVVPGELAIAAFSPPLDPAGNSVKAMAAVAAV
ADSLGHNLYTTRGKVSS
NT seq 954 nt NT seq  +upstreamnt  +downstreamnt
atgtcaagctcatcagatgcgatcaaagccgctcttgagaagggacgcgcagcaggcctt
tctgcaaccggcggcaagaatgccgactatattccattcctggcgtcggttccgtccgac
ctgttcggtctggccgtggtgacggcggacggccagacttttaaaaccggcgatgccgat
ttcgccttcgctatcgagtcgatttccaaggttttcacccttgccctggttatggaggag
attggtcccgatagtgtgcgggaaaaggtcggtgctgacccgaccgggctgccgttcaat
tctgtaatcgcgctcgaactccataacggcaagtcgctttcgccgctggtcaatgcaggc
gcaattgcaactgcaagccttgttcccggcgatacggcggatgcccgctggaacaatatt
ctggaatgccagtgcggttttgcgggccgccggctcaagcttagcaacgaggtcaaccag
tccgaacagacgaccaattttcacaaccgcgccattgcctggctgctttacagtgccggt
acttgctacagcgatccgatggaggccgtggatatttatacgcgccaatgttcaacgctt
gtaaccgcgaccgaccttgccacgatgggggcaacccttgccgccggcggtgttaatccg
atcagcgggaagcgcatggtttcggcaggcaatgttgccccaattctggccgaaatgacc
atggaaggcctttatacggcttcaggcgattgggcttatacggtcggcctacccggtaaa
agcggtgtcggtggtggcatcatggcggtagtgccgggtgagctggcaattgccgcgttt
tcaccgccgcttgatccagccggaaatagtgtgaaagcaatggctgctgttgccgcagtg
gcagattcacttggccataatctttataccaccagagggaaagtgtcatcctga

DBGET integrated database retrieval system