KEGG   Brucella pinnipedialis B2/94: BPI_II925Help
Entry
BPI_II925         CDS       T01589                                 

Gene name
tpiA-2
Definition
(GenBank) triosephosphate isomerase
  KO
K21910  
L-erythrulose 1-phosphate isomerase [EC:5.3.1.33]
Organism
bpp  Brucella pinnipedialis B2/94
Brite
Enzymes [BR:bpp01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.33  L-erythrulose 1-phosphate isomerase
     BPI_II925 (tpiA-2)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
Position
2:911192..911962
Genome map
AA seq 256 aa AA seqDB search
MTKFWIGTSWKMNKTLAEARLFAEALKAADAGRSPDIQRFVIPPFTAVREVKEILSGTSV
KVGAQNMHWADQGAWTGEISPLMLKDCNLDIVELGHSERREHFGETNETVGLKVEAAVRH
GLIPLICIGETLEDRESGRAAAVLEEEVRGALSKLSEAQKQAEILFAYEPVWAIGENGIP
ASADYADARQAEIIAVAQSVLARRVPCLYGGSVNPGNCEELIACPHIDGLFIGRSAWNVE
GYLDILARCATKVQAN
NT seq 771 nt NT seq  +upstreamnt  +downstreamnt
atgaccaaattctggattggcacaagctggaaaatgaacaagacgctggccgaagcccgc
cttttcgcggaagcgctgaaagccgccgatgcaggccgctcgccagacatccagcgtttt
gtcatcccgcctttcaccgccgtgcgtgaggtgaaggaaatcctctccggcacatccgtg
aaggtcggcgcgcagaacatgcactgggccgatcagggtgcatggaccggcgaaatctcc
ccgctgatgctgaaagattgcaatctcgacattgttgaactgggccattcggagcgccgc
gaacatttcggcgagaccaacgagacggtcggcttgaaagtggaagccgccgtgcgccac
ggcctgatcccgctcatctgcatcggtgaaacgctggaagaccgtgaaagcggacgcgca
gccgcggtgcttgaagaagaagtgcgcggcgcgctttccaagctttccgaggcgcagaag
caggccgaaatcctcttcgcctatgagccagtctgggccatcggcgaaaacggcattccc
gcttccgccgactatgccgatgcgcgacaggccgaaatcatcgcggtggcacaaagcgtg
ctcgctcgccgcgtgccgtgcctttatggcggctcggtcaatccgggcaattgcgaagaa
ctgatcgcctgcccgcatatcgatgggcttttcatcggccgttcggcgtggaacgtcgaa
ggctatctcgacattctggccaggtgcgccaccaaggttcaagcgaattaa

DBGET integrated database retrieval system