KEGG   Burkholderia pseudomallei BPC006: BPC006_I0072Help
Entry
BPC006_I0072      CDS       T02301                                 

Definition
(GenBank) putative 3-hydroxyacyl-CoA dehydrogenase
  KO
K01782  3-hydroxyacyl-CoA dehydrogenase / enoyl-CoA hydratase / 3-hydroxybutyryl-CoA epimerase [EC:1.1.1.35 4.2.1.17 5.1.2.3]
Organism
bpq  Burkholderia pseudomallei BPC006
Pathway
bpq00071  Fatty acid degradation
bpq00280  Valine, leucine and isoleucine degradation
bpq00281  Geraniol degradation
bpq00310  Lysine degradation
bpq00362  Benzoate degradation
bpq00380  Tryptophan metabolism
bpq00410  beta-Alanine metabolism
bpq00640  Propanoate metabolism
bpq00650  Butanoate metabolism
bpq00903  Limonene and pinene degradation
bpq00930  Caprolactam degradation
bpq01040  Biosynthesis of unsaturated fatty acids
bpq01100  Metabolic pathways
bpq01110  Biosynthesis of secondary metabolites
bpq01120  Microbial metabolism in diverse environments
bpq01130  Biosynthesis of antibiotics
bpq01200  Carbon metabolism
bpq01212  Fatty acid metabolism
Module
bpq_M00087  beta-Oxidation
Brite
KEGG Orthology (KO) [BR:bpq00001]
 Metabolism
  Carbohydrate metabolism
   00640 Propanoate metabolism
    BPC006_I0072
   00650 Butanoate metabolism
    BPC006_I0072
  Lipid metabolism
   00071 Fatty acid degradation
    BPC006_I0072
   01040 Biosynthesis of unsaturated fatty acids
    BPC006_I0072
  Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    BPC006_I0072
   00310 Lysine degradation
    BPC006_I0072
   00380 Tryptophan metabolism
    BPC006_I0072
  Metabolism of other amino acids
   00410 beta-Alanine metabolism
    BPC006_I0072
  Metabolism of terpenoids and polyketides
   00903 Limonene and pinene degradation
    BPC006_I0072
   00281 Geraniol degradation
    BPC006_I0072
  Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    BPC006_I0072
   00930 Caprolactam degradation
    BPC006_I0072
Enzymes [BR:bpq01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.35  3-hydroxyacyl-CoA dehydrogenase
     BPC006_I0072
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.17  enoyl-CoA hydratase
     BPC006_I0072
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.2  Acting on hydroxy acids and derivatives
    5.1.2.3  3-hydroxybutyryl-CoA epimerase
     BPC006_I0072
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 3HCDH_N ECH_1 3HCDH ECH_2 NAD_binding_8 DAO NAD_binding_2 AlaDh_PNT_C F420_oxidored UDPG_MGDP_dh_N Pyr_redox_2 ApbA
Motif
Other DBs
NCBI-ProteinID: AFR13964
Position
I:70397..72520
Genome map
AA seq 707 aa AA seqDB search
MIDYTLDDDGIATLSWNLPARSQNVLNGESCEAFFAAAARALQDAAVKGMLVTSAKPDFI
AGGDLEWLQASDSAETLFARTCELHRALRALETGGKPVAIAMPGSALGGGLEIALAGHYR
VAADNPKARFGLPEVTLGLLPGGGGTQRLPRLVGVQASLPLLLEGKRLKAADALAAGILH
AVVPAGEEIAAARAWLLDASRRTATQPWDAKGFRIPGGALTHPSVQQVFMAANALARQKT
YGNYPAVASILSCVYEGLLTDLDTGLKTEARYFVKAVLSPEAKAMIRTLFFGMNEANKLA
ARPAGVPTQRYRKVGVLGAGMMGAGIAYVSAKAGLDVVLIDTGEEAAARGKDYSRKLVDK
QVQRGRLAREKADALLAKIVPTTDFARLDGAQLVIEAVFEDRAIKADVTRRSEAVLAPDA
LFASNTSTLPITGLAQASARPANFIGLHFFSPVDKMPLVEVIVGRDTSEATLARALDYVK
TIGMTPIVVNDSRGFYTSRVFSTYVLEGLAMLAEGVAPALIENAGLLAGMPVGPLALTDE
VSSELIHKITRQTRADLGDAYVARPGEDVAARMVELGRLGRKAGLGYYDYPASGGKKALW
PGLAQEFPLAAEQPDVAALIERLVTVQAVETARCLEERVLTTARDADVGAILGWGFPAFR
GGPASYIHGVGVDAFVATCDRLAARHGARFAAPALLREMAAQGRSFY
NT seq 2124 nt NT seq  +upstreamnt  +downstreamnt
atgatcgattacacgctcgatgacgacggcatcgcgaccttgagctggaacctgccggcg
cgcagccagaacgtgctgaacggcgagagctgcgaggcgttcttcgcggcggcggcgcgc
gcgttgcaggatgcggcggtgaagggaatgctcgtcacgtcggcgaagcccgacttcatc
gcgggcggcgacctcgaatggctgcaggcgagcgacagcgccgagacgctcttcgcgcgc
acgtgcgagctgcatcgcgcgctgcgcgcgctcgaaacaggcggcaagccggtggcgatc
gcgatgccgggctcggcgctcggcggtgggctggagatcgcgctcgcgggccactatcgt
gtcgcggccgacaatccgaaggcgcgcttcggcctgcccgaagtgacgctcggcctgctg
ccgggcggcggcggcacgcagcgcctgccgcgtctcgtcggcgtccaggcgtcgctgccg
ctgttgctcgaaggcaagcggctgaaggcggccgacgcgctggccgcgggcatcctgcat
gcggtcgtgccggcgggcgaggagatcgcggccgcgcgcgcgtggctgctcgacgcgagc
cgccgcaccgcgacgcagccgtgggacgcgaagggcttccggattccgggcggcgcgctc
acgcatccgtccgtccagcaggtgttcatggcggcgaacgcgctcgcgcggcagaagacg
tatggcaactacccggccgtcgcgagcatcctgtcgtgcgtgtacgaagggctgctgacc
gatctcgacacgggcttgaagaccgaggcgcgctatttcgtgaaggcggtgctgtcgccg
gaagcgaaggcgatgatccgcacgctgttcttcgggatgaacgaagcgaacaagctcgcc
gcgcggccggccggcgtgccgacgcagcgctaccggaaggtcggcgtgctcggcgcgggg
atgatgggcgcgggcatcgcgtacgtgagcgcgaaggcggggctcgacgtcgtgctgatc
gataccggcgaagaggcggccgcgcgcggcaaggactattcgcgcaagctcgtcgacaag
caggtgcagcgcggccggctcgcgcgggaaaaggccgatgcattgctcgcgaagatcgtg
ccgacgaccgatttcgcgcggctcgacggcgcgcagctcgtgatcgaggcggtgttcgag
gatcgcgcgatcaaggccgacgtcacgcgccggagcgaagcggtgctcgcgcccgacgcg
cttttcgcgtcgaacacgtcgacgctgccgatcacggggctcgcgcaggcgagcgcgcgg
ccggcgaacttcatcggcctgcatttcttctcgccggtggacaagatgccgctcgtcgag
gtgatcgtcggccgcgacacgagcgaggcgacgctcgcgcgcgcgctcgactacgtgaag
acgatcggcatgacgccgatcgtggtcaacgattcgcggggcttctacacgagccgcgtg
ttttcgacgtacgtgctcgaagggctcgcgatgctcgccgagggcgtcgcgcccgcgctg
atcgagaacgccggattgctcgccggcatgccggtgggcccgctcgcgctgaccgacgag
gtgtcgagcgagctgatccacaagatcaccaggcagacgcgcgccgatctcggcgacgcg
tacgtcgcgcgccccggcgaggacgtggccgcgcgcatggtcgaactcggccggctcggc
cgcaaggcggggctcggctattacgactatccggcgagcggcggcaagaaggcgctgtgg
ccggggctcgcgcaggagtttccgctcgcggccgagcagcccgacgtggcggcgctgatc
gagcggctcgtgacggtgcaggcggtcgagaccgcgcgctgcctcgaagagcgcgtgctg
acgacggcgcgcgatgcggacgtcggcgcgattctcggctggggtttcccggcgttccgc
ggcgggcccgcgtcgtacattcacggcgtcggggtggacgcgttcgtcgcgacgtgcgat
cgtcttgccgcgcggcacggcgcgcgtttcgccgcgccggcgttgctgcgcgagatggcg
gcgcaggggcgaagcttctattga

DBGET integrated database retrieval system