KEGG   Burkholderia pseudomallei BPC006: BPC006_I0391Help
Entry
BPC006_I0391      CDS       T02301                                 

Definition
alkaline phosphatase family protein
Orthology
K01077  
alkaline phosphatase [EC:3.1.3.1]
Organism
bpq  Burkholderia pseudomallei BPC006
Pathway
Aminobenzoate degradation
Folate biosynthesis
Metabolic pathways
Microbial metabolism in diverse environments
Two-component system
Module
Tetrahydrofolate biosynthesis, GTP => THF
Brite
KEGG Orthology (KO) [BR:bpq00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    BPC006_I0391
  Xenobiotics biodegradation and metabolism
   00627 Aminobenzoate degradation
    BPC006_I0391
 Environmental Information Processing
  Signal transduction
   02020 Two-component system
    BPC006_I0391
Enzymes [BR:bpq01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.1  alkaline phosphatase
     BPC006_I0391
Exosome [BR:bpq04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   BPC006_I0391
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
I:353389..354816
Genome map
AA seq 475 aa AA seqDB search
MTGNRGIQDVDYQAHRGGGVRRGGLSGGFGHAAHAAGQAKNVIFFLGDGMGPATVTASRL
YKVGEAGQLTMEKLPRTARIKTFSNDAQTTDSAPSMAAYMTGVKMNNEVLSMSPDTRAIA
PGSDANGNKTVNRCGVGNGTPATTLLELAKARGKAVGAITTTELTHATPAATYSHICHRD
AQYDIAAQAVPGGAGYNAALGDGVDVLMGGGRNHWTPYDPLANRRGRADGRNLLAELQAK
GYAVVATKDQLAQAGAGKLIGLFSTTSHLEYELDRVAGKGEGATQPSLAEMTAKAIDVLR
KNPNGYFLMVEGGRIDHALHGTNAKRALEDTVAFDEAIRTALAKVDLSDTLIVVTADHDH
TMTINGYSKRGNPVLDISRNYRDGQPNKDADGNPYTTLVFGNGANRPNVRVPVDSSTATN
DAYLQEVGVRMGSAGSETHGGGDVMLFADGAGAKAFKGTLDNTKVFGLVKAAFGF
NT seq 1428 nt NT seq  +upstreamnt  +downstreamnt
ttgacgggaaacaggggaatacaggatgtcgactatcaagcgcatcgcggcggcggcgtt
cgccgcggcggcctctcgggcggtttcggccacgcggcgcacgccgcgggccaggcgaag
aacgtgatcttcttcctcggcgacgggatggggccggccaccgtgacggcgagccgcctc
tacaaggtcggcgaagccggccaactgacgatggaaaagctgccgcgcaccgcgcgcatc
aagaccttctcgaacgacgcgcagacgacggacagcgcaccgtcgatggccgcgtacatg
accggcgtgaagatgaacaacgaggtgctgtcgatgtcgccggacacgcgcgcgatcgcc
cccggcagcgatgcgaacggcaacaagacggtgaaccgctgcggcgtgggcaacggcacg
ccggcgacgacgctgctcgagctcgcgaaggcgcgcggcaaggcggtcggcgcgatcacg
acgaccgagctcacgcacgcgacgcccgcggcgacttactcgcacatctgccatcgcgac
gcgcagtacgacattgccgcgcaggccgtgccgggcggcgcgggctacaacgcggcgctc
ggcgacggcgtcgacgtgctgatgggcggcggccgcaatcactggacgccgtacgatccg
ctcgccaacaggcgcggccgcgcggacgggcgcaacctgctcgccgagctgcaggcgaag
ggctacgcggtggtcgcgacgaaggatcagctcgcgcaggcgggcgcgggcaagctgatc
ggccttttcagcacgacgagccatctcgaatacgagctcgaccgcgtcgcgggcaagggc
gagggcgcgacgcagccgagcctcgcggagatgaccgcgaaggcgatcgacgtgttgcgg
aagaatccgaacggctatttcctgatggtcgaaggcgggcgcatcgaccacgcgctgcac
ggcacgaacgcgaagcgcgcgctcgaagacacggtggcgttcgacgaggcgatccgcacc
gcgctcgcgaaggtcgatctatcggatacgctgatcgtcgtgacggccgatcacgatcac
acgatgacgatcaacggctattcgaagcgcggcaatccggtgctcgacatcagccgcaac
tatcgcgacggccagccgaacaaggacgcggacggcaacccgtacacgacgctcgtgttc
ggcaatggcgcgaaccggccgaacgtgcgcgtgccggtggattcgtcgacggcgacgaac
gacgcgtatctgcaggaagtcggcgtgcgcatgggcagcgcgggttccgagacgcatggc
ggcggcgacgtgatgctgttcgccgacggcgccggcgcgaaggcgttcaagggcacgctc
gacaacacgaaggtgttcggcctcgtgaaggccgcgttcgggttctga

DBGET integrated database retrieval system