KEGG   Burkholderia pseudomallei BPC006: BPC006_I0425Help
Entry
BPC006_I0425      CDS       T02301                                 

Definition
(GenBank) enoyl-CoA hydratase
  KO
K01692  enoyl-CoA hydratase [EC:4.2.1.17]
Organism
bpq  Burkholderia pseudomallei BPC006
Pathway
bpq00071  Fatty acid degradation
bpq00280  Valine, leucine and isoleucine degradation
bpq00281  Geraniol degradation
bpq00310  Lysine degradation
bpq00360  Phenylalanine metabolism
bpq00362  Benzoate degradation
bpq00380  Tryptophan metabolism
bpq00410  beta-Alanine metabolism
bpq00627  Aminobenzoate degradation
bpq00640  Propanoate metabolism
bpq00650  Butanoate metabolism
bpq00903  Limonene and pinene degradation
bpq00930  Caprolactam degradation
bpq01100  Metabolic pathways
bpq01110  Biosynthesis of secondary metabolites
bpq01120  Microbial metabolism in diverse environments
bpq01130  Biosynthesis of antibiotics
bpq01212  Fatty acid metabolism
Module
bpq_M00087  beta-Oxidation
Brite
KEGG Orthology (KO) [BR:bpq00001]
 Metabolism
  Carbohydrate metabolism
   00640 Propanoate metabolism
    BPC006_I0425
   00650 Butanoate metabolism
    BPC006_I0425
  Lipid metabolism
   00071 Fatty acid degradation
    BPC006_I0425
  Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    BPC006_I0425
   00310 Lysine degradation
    BPC006_I0425
   00360 Phenylalanine metabolism
    BPC006_I0425
   00380 Tryptophan metabolism
    BPC006_I0425
  Metabolism of other amino acids
   00410 beta-Alanine metabolism
    BPC006_I0425
  Metabolism of terpenoids and polyketides
   00903 Limonene and pinene degradation
    BPC006_I0425
   00281 Geraniol degradation
    BPC006_I0425
  Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    BPC006_I0425
   00627 Aminobenzoate degradation
    BPC006_I0425
   00930 Caprolactam degradation
    BPC006_I0425
Enzymes [BR:bpq01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.17  enoyl-CoA hydratase
     BPC006_I0425
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ECH_1 ECH_2
Motif
Other DBs
NCBI-ProteinID: AFR14315
Position
I:388995..389822
Genome map
AA seq 275 aa AA seqDB search
MTDLALYAGYEALRIQRRPHGIVEIVMSGEGANRSGLAVASEAMHRELADIWRDVDRDPD
ARVAVIRGEGKGFSAGGDLALVERMADAHAVRERVWREARDLVYNVINCSKPIVSAMHGP
AVGAGLVAGLLADVSIAAKHARIIDGHTRLGVAAGDHAAIVWPLLCGMAKAKYHLLLCEP
VSGEEAERIGLVSLALDDHELLPKAYEIAERLAQGSQSAIRWTKYALNNWLRLAGPTFDA
SLALEFMGFSGPDVREGIRSLRERRAPDFTGGAPS
NT seq 828 nt NT seq  +upstreamnt  +downstreamnt
atgaccgatctcgctctctatgccggctatgaagcgctgcgcatccagcgccggccgcac
ggcatcgtcgaaatcgtgatgagcggcgaaggcgcgaaccgcagcggcctcgcggtcgcg
agcgaggcgatgcaccgcgagctcgccgatatctggcgcgacgtcgaccgcgatcccgac
gcgcgcgtcgcggtgatccgcggcgaaggcaagggcttctcggcgggcggcgatctcgcg
ctcgtcgagcgcatggccgacgctcacgcggtgcgcgagcgcgtctggcgcgaagcgcgc
gatctcgtctacaacgtgatcaattgcagcaagccgatcgtgtcggcgatgcacgggccg
gccgtcggcgccgggctcgtcgccgggctgctcgccgacgtgtcgatcgccgcgaagcac
gcgcggatcatcgacgggcacacgcgtctcggcgtcgccgcgggcgatcacgcggcgatc
gtctggccgctgctctgcgggatggcgaaggcgaaataccacctgctcctctgcgagccc
gtgagcggcgaggaggccgagcgcatcgggctcgtgtcgctcgcgctcgacgatcacgag
ctgctgccgaaggcgtacgagatcgccgagcgcctcgcgcaaggctcgcaaagcgcgatc
cgctggaccaagtacgcgctcaacaactggctgcggctggccgggccgaccttcgacgcg
tcgctcgcgctcgaattcatgggtttttccgggccggacgtgcgcgaaggcattcgctcg
ctgcgcgagcgccgcgcgccggatttcacgggcggcgcgccgtcttga

DBGET integrated database retrieval system