KEGG   Burkholderia pseudomallei BPC006: BPC006_I0547Help
Entry
BPC006_I0547      CDS       T02301                                 

Definition
glucosyl hydrolase family protein
Orthology
K12373  
hexosaminidase [EC:3.2.1.52]
Organism
bpq  Burkholderia pseudomallei BPC006
Pathway
Other glycan degradation
Amino sugar and nucleotide sugar metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:bpq00001]
 Metabolism
  Carbohydrate metabolism
   00520 Amino sugar and nucleotide sugar metabolism
    BPC006_I0547
  Glycan biosynthesis and metabolism
   00511 Other glycan degradation
    BPC006_I0547
Enzymes [BR:bpq01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.52  beta-N-acetylhexosaminidase
     BPC006_I0547
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
I:complement(510727..513297)
Genome map
AA seq 856 aa AA seqDB search
MKDPIAATYFHGVVSPFFCQGTPMNRISHSLCAALLAAATLLPTASRAQLPARPMAGAAA
PATAAPVRPASTPAELAARLANGLAVRVAVDNNHAASAGVPCADLGADWASCATGRLILQ
NRGHSPLTDGGWKLYLHSIRRLLRIDRPGFTLRHLTGDLYELTPQPGTVRLAQGERIELP
FVAEYWLRRYSDVIPRPYVVVDGAAPAVLRYDDTDDELRYVETLPADAQNNSPGNAPPAA
AQPVANRALPSVKRQRALPGALDLRGVELTLPELPSAQVAALRERAGTLGLDGARVPVWG
VVAPRRLPADIAVPGGYRLAIGPRGAFIEGADRAGLYYGVQTLFSLVPAGGATVPAMLIE
DAPRFTHRGMHVDLARNFKPAATLRRLIDQMSAYKLNRLHLHLSDDEGWRIEIPGLPELT
DVGARRCHDPSETRCLLPQLGSGPDDRSGGGYLTRDDYVALLRYAAERFVEVIPEIDMPA
HSRAAVVSMEARYRRLHAAGREREANAYRLLDAQDTSNLLTVQFYDRRSDLNPCMPGALN
FASKVIREIASMHADAQAPLRIWHFGGDEAKNILLGAGFQPLDGADPGKGRVDLAAQDKP
WARSPACTALLRRGEIKSIDELPTRFAKQVSAIVNANGIGTMAAWQDGIKHASGPREFST
RHVMVSLWDTIFWGASDSARDLSAKGYRTVLALPDYLYFDFPYTRNPRERGYYWGSQATD
EYKVFSLAPENLPQNAEVFGDRDGNPFEVTSAGAAPSIEGIQGQAWGEVMRNGQLLEYMV
YPRLLALAERAWHKADWELPYAAGVRYKLGDTHHVDTAALERDWAGFATVLKQRELPKLE
RAGIGYRKPTFTLTGE
NT seq 2571 nt NT seq  +upstreamnt  +downstreamnt
ttgaaagacccgatcgcagcgacgtatttccacggcgtcgtatcgccgtttttttgccaa
ggaacgcccatgaaccgaatttcgcattccctgtgcgccgcgctattggccgccgcgacg
ctgttgcccacggcctcgcgcgcgcaactgcccgcgcgccccatggccggcgcggccgcg
cccgcgacggccgcgcccgtgcggcccgcgtccacgccggccgagctcgccgcgcggctc
gccaacggcctcgcggtgcgcgtggccgtcgacaacaatcacgcggcatcggccggcgtg
ccgtgcgccgacctcggcgcggactgggcgagctgcgcgacgggccgcctgatcctgcag
aatcgcggccactcgcccctcaccgacggcggctggaagctctatctgcacagcatccgc
cggctgctccgaatcgaccgccccggcttcacgctgcgccatctgacgggcgatctatac
gagctgacgccgcagcccggcacggtaaggctcgcgcagggcgagcgcatcgagctgccg
ttcgtcgccgaatactggctgcgccgctacagcgacgtgatcccgcgcccgtacgtggtc
gtcgacggcgcggcgcccgcggtgctgcgctacgacgataccgacgacgagctgcgctac
gtcgaaacgctgcccgccgacgcgcagaacaattcgcccggcaatgcgccgcccgccgcc
gcgcagccggtggcgaaccgcgcgctgcccagcgtgaagcggcagcgcgcgctgcccggc
gcgctcgatctgcgcggcgtcgagctgacgctgccggagctgccgtccgcgcaggtcgcg
gcgctgcgcgaacgtgcgggcacgctcggcctggacggcgcgcgcgtgccggtgtggggc
gtcgtcgcgccgcgccggctgcccgccgacatcgcggtgccgggcggctaccggctcgcg
atcggcccgcgcggcgcgttcatcgagggggccgatcgcgcgggcctctactacggcgtg
cagacgctcttctcgctcgtgccggccggcggcgcgacggtgcccgcgatgctgatcgaa
gacgcgccgcgcttcacgcaccgcgggatgcacgtcgatctcgcgcgcaacttcaagccg
gccgccacgctgcgccggctgatcgaccagatgagcgcgtacaagctcaaccggctgcat
ctgcacctgtccgacgacgagggctggcgcatcgagattcccggcctgcccgagctgacc
gacgtcggcgcgcgccgctgccacgacccgagcgagacgcgctgcctgctgccgcagctc
ggctcggggcccgacgatcgttcgggcggcggctacctgacgcgcgacgactacgtcgcg
ctgctgcgctacgcggccgagcgcttcgtcgaagtgatccccgagatcgacatgcccgcg
cactcgcgcgcggccgtcgtatcgatggaggcgcgctatcgccgcctgcacgcggcgggc
cgcgagcgggaagcgaacgcgtatcggctgctcgatgcgcaggacacgtcgaacctgctg
accgtgcagttctacgaccggcgcagcgatctgaacccgtgcatgccgggcgcgctgaac
ttcgcgtcgaaggtgatccgcgagatcgcgtcgatgcacgcggacgcgcaagcgccgctg
cggatctggcacttcggcggcgacgaggcgaagaacatcctgctcggcgcgggcttccag
ccgctcgacggcgccgatcccggcaagggccgcgtcgatctcgccgcgcaggacaagccg
tgggcgcgctcgcccgcctgtacggcgctgcttcggcgcggcgagatcaaatcgatcgac
gaattgccgacgcgcttcgcgaagcaggtcagcgcgatcgtgaacgcgaacggaatcggc
acgatggccgcgtggcaggacggcatcaagcacgcgagcgggccgcgggagttcagcacg
cggcacgtgatggtgtcgctgtgggacaccatcttctggggcgcgtccgacagcgcgcgc
gatctgagcgcgaagggctaccggaccgtgctcgcgctgcccgattacctgtacttcgat
ttcccgtacacgcgcaatccgcgcgagcgcggctattactggggctcgcaggcgacggac
gagtacaaggtgttctcgctcgcgccggagaacctgccgcagaacgccgaggtgttcggc
gatcgcgacggcaacccgttcgaggtgacgagcgcaggcgcggcgccgagcatcgagggc
atccaggggcaggcgtggggcgaggtgatgcgcaacgggcaactgctcgaatacatggtg
tatccgcgccttctcgcgctcgccgagcgcgcgtggcacaaggccgactgggaactgccc
tacgcggccggcgtgcgctacaagctcggcgacacgcatcacgtcgacacggccgcgctc
gagcgcgactgggcgggcttcgcgacggtgctcaagcagcgcgaactgccgaagctcgag
cgtgcgggcatcgggtatcgcaagccgacgtttacgctgacgggcgaatga

DBGET integrated database retrieval system