KEGG   Burkholderia pseudomallei BPC006: BPC006_I0580Help
Entry
BPC006_I0580      CDS       T02301                                 

Definition
formamidopyrimidine-DNA glycosylase
Orthology
K10563  
formamidopyrimidine-DNA glycosylase [EC:3.2.2.23 4.2.99.18]
Organism
bpq  Burkholderia pseudomallei BPC006
Pathway
Base excision repair
Class
Genetic Information Processing; Replication and repair; Base excision repair [PATH:bpq03410]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
I:542955..543776
Genome map
AA seq 273 aa AA seqDB search
MPEVEVTRRGIEPFVAGRRVERVDVRTAMLRWPVPAGFAEMLRSREVLRVERRGKYLLFE
VDAGWFIVHLGMTGTLRVLPNDAPPPAPAKHDHVDWIFDEFVLRFRDPRRFGAVLWHPRD
AGDVHAHPLLASLGVEPFSAAFSGALLFGRTRGRTVSVKQALLAGDIVVGVGNIYASESL
FRAGIRPTTAAGRVSLPRYERLADAVRATLADAIERGGSTLRDFVGSNGESGYFQLDCFV
YDRAGEPCRVCGAPIRQIVQGQRSTYFCPNCQR
NT seq 822 nt NT seq  +upstreamnt  +downstreamnt
ttgccggaagtcgaggttacgcgccggggcatcgagccgttcgtcgccgggcggcgcgtc
gagcgcgtcgacgtgcgcaccgccatgctgcgctggcccgtgcccgccggcttcgccgag
atgctccgatcgcgcgaggtgctgcgcgtcgagcggcgcggcaagtatctgctgttcgaa
gtcgacgccggctggttcatcgtccatctcggcatgacgggcacgctgcgcgtgctgccg
aacgacgcgccgccgcccgcgccggcgaagcacgatcacgtcgactggattttcgacgaa
ttcgtgctgcgctttcgcgatccgcgccgtttcggcgcggtgctctggcatccgcgcgac
gcgggcgacgtgcacgcgcatccgctgctcgcgagcctcggtgtcgagccgttctcggcc
gcgttctcgggcgcgctcctcttcggccgcacgcgcgggcgcacggtgtccgtcaagcag
gcgctgctcgcgggtgacatcgtcgtcggcgtcggcaacatctatgcgtccgagagcctc
tttcgcgcgggcatccggccgaccacggcggcggggcgcgtatcgctgccgcgctacgag
cggctcgccgacgcggtgcgcgcgacgctcgccgatgcgatcgagcgcggcggcagcacg
ctgcgcgacttcgtcggcagcaacggcgagagcggctatttccagctcgactgcttcgtc
tacgatcgcgcgggcgagccgtgccgcgtctgcggcgcgccgatccgccagatcgtccag
gggcagcgatccacctatttctgtccgaattgtcagcgttaa

DBGET integrated database retrieval system