KEGG   Burkholderia pseudomallei BPC006: BPC006_I0805Help
Entry
BPC006_I0805      CDS       T02301                                 

Definition
(RefSeq) succinyl-CoA synthetase subunit beta
  KO
K01903  
succinyl-CoA synthetase beta subunit [EC:6.2.1.5]
Organism
bpq  Burkholderia pseudomallei BPC006
Pathway
Citrate cycle (TCA cycle)
Propanoate metabolism
C5-Branched dibasic acid metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Module
Citrate cycle (TCA cycle, Krebs cycle)
Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:bpq00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    BPC006_I0805
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    BPC006_I0805
   00640 Propanoate metabolism
    BPC006_I0805
   00660 C5-Branched dibasic acid metabolism
    BPC006_I0805
Enzymes [BR:bpq01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.5  succinate---CoA ligase (ADP-forming)
     BPC006_I0805
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
I:786045..787211
Genome map
AA seq 388 aa AA seqDB search
MKIHEYQGKEILRKFGVAVPRGKPAFSVDEAVKVAQELGGPVWVVKAQIHAGGRGKGGGV
KVAKSLEQVREYSNQILGMQLKTHQTGPEGQKVNRLLIEEGADIKKELYVGIVIDRVSQK
VVVMASSEGGMDIEEVAEKTPEAIHKVAVEPSVGLQDAEADDLAKKIGVPDASIPQAREI
LKGLYKSFWETDASLAEINPLVLTGDGKVIALDAKFNFDSNALFRHPEIVAYRDLDEEDP
AEIEASKFDLAYISLDGNIGCLVNGAGLAMATMDTIKLFGGEPANFLDVGGGATTEKVTE
AFKLMLKNPGLKAILVNIFGGIMRCDVIAEGVIAGSKAVNLNVPLVVRMKGTNEDLGKKM
LAESGLPIISADSMEEAAQKVVAAAAGK
NT seq 1167 nt NT seq  +upstreamnt  +downstreamnt
atgaagattcacgagtaccagggtaaggaaatcctgcggaaattcggagtcgcggtaccg
cgcggcaagccggcgttctcggtggacgaggccgtcaaggtggcgcaagagctgggcggc
ccggtctgggtcgtcaaggcccagattcatgcgggcggccgcggcaagggcggcggcgtg
aaggtcgcgaagtcgctcgagcaagtgcgcgaatactcgaaccagatcctcggcatgcag
ctgaagacgcaccagacgggcccggaaggccagaaggtcaaccgtctgctgatcgaagaa
ggcgcggacatcaagaaggaactgtatgtcggcatcgtgatcgatcgcgtgtcgcagaag
gtcgtcgtgatggcgtcgagcgaaggcggcatggacatcgaggaagtcgcggaaaagacg
ccggaagcgatccacaaggtcgccgtcgagccatcggtgggcctgcaggatgccgaagcc
gacgatctcgcgaagaagatcggcgtgccggacgcatcgatcccgcaagcgcgcgaaatc
ctgaagggcctgtacaagtcgttctgggaaacggacgcgtcgctcgccgaaatcaacccg
ctcgtgctgacgggcgacggcaaggtgatcgcgctcgacgcgaagttcaacttcgattcg
aacgcgctgttccgccatccggaaatcgtcgcgtaccgcgatctggacgaagaagatccg
gctgaaatcgaagcgtcgaagttcgacctcgcgtacatctcgctcgacggcaacatcggc
tgcctcgtgaacggcgcgggcctggcgatggcgacgatggatacgatcaagctgttcggc
ggcgagccggcgaacttcctcgacgtcggcggcggcgcaacgaccgagaaggtcaccgaa
gcgttcaagctgatgctgaagaacccgggcctgaaggcgatcctcgtgaacatcttcggc
ggcatcatgcgctgcgacgtgatcgcggaaggcgtgatcgcgggctcgaaggccgtgaac
ctgaacgtgccgctcgtcgtgcgcatgaagggcacgaacgaagacctcggcaagaagatg
cttgcggaatccggcctgccgatcatctcggcggacagcatggaagaagcggcgcagaag
gtcgtcgccgcggctgcgggcaagtaa

DBGET integrated database retrieval system