KEGG   Burkholderia pseudomallei BPC006: BPC006_I1068Help
Entry
BPC006_I1068      CDS       T02301                                 

Definition
bifunctional uroporphyrinogen-III synthetase/uroporphyrin-III C-methyltransferase
Orthology
K13543  
uroporphyrinogen III methyltransferase / synthase [EC:2.1.1.107 4.2.1.75]
Organism
bpq  Burkholderia pseudomallei BPC006
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:bpq00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    BPC006_I1068
Enzymes [BR:bpq01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.107  uroporphyrinogen-III C-methyltransferase
     BPC006_I1068
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.75  uroporphyrinogen-III synthase
     BPC006_I1068
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
I:1043308..1045287
Genome map
AA seq 659 aa AA seqDB search
MAGAPRTFTAVLTRPDGQSAALAAQLAAAGIDVLDFPLIDIAPLADDAPLAEAFARLDAY
ALVVFVSPNAVDHALARLGAIWPHPLPIGVVGPGSVAALARHGIAAPAHRVIAPSAPDDG
GEPHYDSESLFAEIARAFNGEAKLAGKRVLIVRGDGGREWLAERLREAGAEVELVAAYRR
VSPEPSIGAWERVHALLSGAPHAWLVTSSEGVRNLQELAHEHLNETEIDALKHARFVAPH
SRIVETARALGFDRITLTGAGDERIVRAFRTLADQADQPATAAPMPSRMTDTNDTKDVSS
KPAAAPVAPPNQPFTPFETKERRGAASAALWFVVVVIAAAAGVGGYALNRKVDRLDQHAT
ERQKALDAQTAELRTKTEQALASVRQADSQLSQLEGKLADAQTAQTALQQQYQDLSRNRD
AWMIEEVGQMLSSASQQLLLTGNTQLALIALQNADARLASSQSAQAVVVRKAIAQDIERL
KAAPSADLTGLAIKLDDAIAKVDTLPLAGEVLAPHAQAKPDAAASARQAAAAAGEPRWKA
WWRGFSAGIGEQLKSLVEVRRIDHADAMLASPEQGYFVRENVKLRLLSARLSLLARDDGA
MKSDLHAAQAAVARYFDGASKDTRVVQDLLKQVDAASLTVAVPNLNTSLNAVQQFKSRG
NT seq 1980 nt NT seq  +upstreamnt  +downstreamnt
atggcgggcgcgccgcgcacgttcaccgcggtgctcacgcgccccgacggacagtcggcg
gcgctcgcggcgcagctcgcggcggcgggcatcgacgtgctcgactttccgctcatcgac
atcgcgccgctcgccgacgacgcgccgctcgccgaagcgttcgcgcggctcgacgcgtat
gcgctcgtcgtgttcgtgtcgccgaacgcggtcgatcacgcgctcgcgcggctcggcgcg
atctggccgcatccgctgccgatcggcgtcgtcgggccgggcagcgtcgccgcgctcgcg
cggcacggcatcgccgcgcccgcgcatcgcgtgatcgcgccgagcgcgcccgacgacggc
ggcgagccgcactacgattccgagagcctgttcgccgagatcgcgcgtgcgttcaacggc
gaggcgaagctcgccggcaagcgcgtgctgatcgtgcgcggcgacggcggccgcgaatgg
cttgccgagcgcctgcgcgaggcgggcgccgaagtcgagctcgtcgccgcgtatcggcgc
gtgagcccggagccttcgatcggcgcgtgggagcgcgtgcacgcgctgctgtcgggcgcg
ccgcacgcgtggctcgtgacgagctcggagggcgtgcgcaatctgcaggagctcgcgcac
gagcatttgaacgaaacggagatcgacgcgctcaagcacgcccggttcgtcgcgccgcat
tcgaggatcgtcgagaccgcgcgcgcactcggttttgataggattacgctgaccggcgcg
ggcgatgagcgcatcgtccgcgcgtttcgtacgttggccgatcaggccgatcaaccggcg
acagccgcaccgatgccttctcgcatgacagacaccaacgataccaaagacgtctcttcc
aaaccggccgcggctcccgttgcgccgccgaatcaaccgtttacgccgtttgaaacgaag
gagcggcgcggcgcggcgagcgcggcgctctggttcgtggtcgtcgtgatcgcggccgcg
gcgggcgtcggcggctatgcgctgaaccgcaaggtcgaccgcctcgatcagcacgcgacc
gagcggcaaaaggcgctcgacgcgcaaacggccgagctccgcacgaagaccgaacaggcg
ctcgcgagcgtgcgccaggccgattcgcaactgtcgcagctcgaaggcaagctcgccgac
gcgcagaccgcgcagaccgcgctgcagcagcaatatcaggatctgtcgcgcaaccgcgac
gcgtggatgatcgaggaagtcggtcagatgctgtcgagcgcgagccagcaactgctgctc
acgggcaacacgcagctcgcgctgatcgcgctgcagaacgccgatgcgcggctcgcgtcg
tcgcagagcgcgcaggcggtcgtcgtgcgcaaggcgatcgcgcaggatatcgaacggttg
aaggccgcgccttcggcggatctcacggggcttgcgatcaagctcgacgacgcgatcgcg
aaggtcgacacgctgccgctcgcgggcgaagtgctcgcgccgcacgcgcaggcgaagccc
gacgccgccgcgagcgcccggcaggcggccgcggcggcgggcgagccgcgctggaaggcc
tggtggcgcggcttctcggcgggcatcggcgagcaactgaagtcgctcgtcgaggtgcgc
cgcatcgatcacgcggacgcgatgctcgcgtcgcccgaacagggctacttcgtgcgcgag
aacgtgaagctgcgtctgctgagcgcgcggctgtcgctgctcgcgcgcgacgacggcgcg
atgaagtccgatctgcatgccgcgcaggcggccgtggcgcgctacttcgacggcgcatcg
aaggacacccgggtcgttcaggatctgctcaagcaggtcgacgccgcgtcgctgacggtc
gcggtgccgaacctcaatacgagcctgaacgcggttcaacagttcaagagccggggttga

  All links  
No link information was found.   
DBGET integrated database retrieval system