KEGG   Burkholderia pseudomallei BPC006: BPC006_I1068Help
Entry
BPC006_I1068      CDS       T02301                                 

Definition
bifunctional uroporphyrinogen-III synthetase/uroporphyrin-III C-methyltransferase
Orthology
K13543  
uroporphyrinogen III methyltransferase / synthase [EC:2.1.1.107 4.2.1.75]
Organism
bpq  Burkholderia pseudomallei BPC006
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Class
Metabolism; Metabolism of cofactors and vitamins; Porphyrin and chlorophyll metabolism [PATH:bpq00860]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
I:1043308..1045287
Genome map
AA seq 659 aa AA seqDB search
MAGAPRTFTAVLTRPDGQSAALAAQLAAAGIDVLDFPLIDIAPLADDAPLAEAFARLDAY
ALVVFVSPNAVDHALARLGAIWPHPLPIGVVGPGSVAALARHGIAAPAHRVIAPSAPDDG
GEPHYDSESLFAEIARAFNGEAKLAGKRVLIVRGDGGREWLAERLREAGAEVELVAAYRR
VSPEPSIGAWERVHALLSGAPHAWLVTSSEGVRNLQELAHEHLNETEIDALKHARFVAPH
SRIVETARALGFDRITLTGAGDERIVRAFRTLADQADQPATAAPMPSRMTDTNDTKDVSS
KPAAAPVAPPNQPFTPFETKERRGAASAALWFVVVVIAAAAGVGGYALNRKVDRLDQHAT
ERQKALDAQTAELRTKTEQALASVRQADSQLSQLEGKLADAQTAQTALQQQYQDLSRNRD
AWMIEEVGQMLSSASQQLLLTGNTQLALIALQNADARLASSQSAQAVVVRKAIAQDIERL
KAAPSADLTGLAIKLDDAIAKVDTLPLAGEVLAPHAQAKPDAAASARQAAAAAGEPRWKA
WWRGFSAGIGEQLKSLVEVRRIDHADAMLASPEQGYFVRENVKLRLLSARLSLLARDDGA
MKSDLHAAQAAVARYFDGASKDTRVVQDLLKQVDAASLTVAVPNLNTSLNAVQQFKSRG
NT seq 1980 nt NT seq  +upstreamnt  +downstreamnt
atggcgggcgcgccgcgcacgttcaccgcggtgctcacgcgccccgacggacagtcggcg
gcgctcgcggcgcagctcgcggcggcgggcatcgacgtgctcgactttccgctcatcgac
atcgcgccgctcgccgacgacgcgccgctcgccgaagcgttcgcgcggctcgacgcgtat
gcgctcgtcgtgttcgtgtcgccgaacgcggtcgatcacgcgctcgcgcggctcggcgcg
atctggccgcatccgctgccgatcggcgtcgtcgggccgggcagcgtcgccgcgctcgcg
cggcacggcatcgccgcgcccgcgcatcgcgtgatcgcgccgagcgcgcccgacgacggc
ggcgagccgcactacgattccgagagcctgttcgccgagatcgcgcgtgcgttcaacggc
gaggcgaagctcgccggcaagcgcgtgctgatcgtgcgcggcgacggcggccgcgaatgg
cttgccgagcgcctgcgcgaggcgggcgccgaagtcgagctcgtcgccgcgtatcggcgc
gtgagcccggagccttcgatcggcgcgtgggagcgcgtgcacgcgctgctgtcgggcgcg
ccgcacgcgtggctcgtgacgagctcggagggcgtgcgcaatctgcaggagctcgcgcac
gagcatttgaacgaaacggagatcgacgcgctcaagcacgcccggttcgtcgcgccgcat
tcgaggatcgtcgagaccgcgcgcgcactcggttttgataggattacgctgaccggcgcg
ggcgatgagcgcatcgtccgcgcgtttcgtacgttggccgatcaggccgatcaaccggcg
acagccgcaccgatgccttctcgcatgacagacaccaacgataccaaagacgtctcttcc
aaaccggccgcggctcccgttgcgccgccgaatcaaccgtttacgccgtttgaaacgaag
gagcggcgcggcgcggcgagcgcggcgctctggttcgtggtcgtcgtgatcgcggccgcg
gcgggcgtcggcggctatgcgctgaaccgcaaggtcgaccgcctcgatcagcacgcgacc
gagcggcaaaaggcgctcgacgcgcaaacggccgagctccgcacgaagaccgaacaggcg
ctcgcgagcgtgcgccaggccgattcgcaactgtcgcagctcgaaggcaagctcgccgac
gcgcagaccgcgcagaccgcgctgcagcagcaatatcaggatctgtcgcgcaaccgcgac
gcgtggatgatcgaggaagtcggtcagatgctgtcgagcgcgagccagcaactgctgctc
acgggcaacacgcagctcgcgctgatcgcgctgcagaacgccgatgcgcggctcgcgtcg
tcgcagagcgcgcaggcggtcgtcgtgcgcaaggcgatcgcgcaggatatcgaacggttg
aaggccgcgccttcggcggatctcacggggcttgcgatcaagctcgacgacgcgatcgcg
aaggtcgacacgctgccgctcgcgggcgaagtgctcgcgccgcacgcgcaggcgaagccc
gacgccgccgcgagcgcccggcaggcggccgcggcggcgggcgagccgcgctggaaggcc
tggtggcgcggcttctcggcgggcatcggcgagcaactgaagtcgctcgtcgaggtgcgc
cgcatcgatcacgcggacgcgatgctcgcgtcgcccgaacagggctacttcgtgcgcgag
aacgtgaagctgcgtctgctgagcgcgcggctgtcgctgctcgcgcgcgacgacggcgcg
atgaagtccgatctgcatgccgcgcaggcggccgtggcgcgctacttcgacggcgcatcg
aaggacacccgggtcgttcaggatctgctcaagcaggtcgacgccgcgtcgctgacggtc
gcggtgccgaacctcaatacgagcctgaacgcggttcaacagttcaagagccggggttga

DBGET integrated database retrieval system