KEGG   Burkholderia pseudomallei BPC006: BPC006_I1169Help
Entry
BPC006_I1169      CDS       T02301                                 

Definition
hypothetical protein
Orthology
K01185  
lysozyme [EC:3.2.1.17]
Organism
bpq  Burkholderia pseudomallei BPC006
Brite
Enzymes [BR:bpq01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.17  lysozyme
     BPC006_I1169
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
I:1133160..1133666
Genome map
AA seq 168 aa AA seqDB search
MVSMAKLPKKTLAGVVGAIAAGVLTVIVPKFEGVKLAGYLDPVGIPTKCMGDTRDVIVGR
TYSEAECRQSLETQLIAHAEPVLRCTPGLKDRPYQLAAAVSFAYNVGANAYCASTTARRF
NAGDLRGACRAINEADDGRPQWVTAGGRVLPGLVKRRAAERALCEREL
NT seq 507 nt NT seq  +upstreamnt  +downstreamnt
gtggtaagcatggctaagttgccgaagaagacgctcgccggcgtcgtcggcgcgatcgcg
gccggtgtgctgacggtgatcgtgccgaagttcgagggcgtcaagctggcgggctacctc
gatccggtcggcattccgacgaagtgcatgggcgacacgcgcgacgtcatcgttggcagg
acatacagcgaggccgagtgtcgccagtcgctcgaaacgcaattgatcgcgcacgctgaa
cccgtgctgcgttgcacgccggggctgaaagatcgtccgtatcagctcgcggcggccgtc
agctttgcatacaacgtcggcgcgaacgcctactgcgccagcacgacggcgaggcgcttc
aacgcgggcgacctgcgcggcgcgtgccgcgcgatcaacgaggccgatgacggacgcccg
caatgggtcactgccggtggtcgtgtgctgcccggcctcgtgaaacgccgtgcggccgag
cgcgcgctgtgtgagcgggagctgtga

DBGET integrated database retrieval system