KEGG   Burkholderia pseudomallei BPC006: BPC006_I1340Help
Entry
BPC006_I1340      CDS       T02301                                 

Definition
triosephosphate isomerase
Orthology
K01803  
triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
bpq  Burkholderia pseudomallei BPC006
Pathway
Glycolysis / Gluconeogenesis
Fructose and mannose metabolism
Inositol phosphate metabolism
Carbon fixation in photosynthetic organisms
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Glycolysis, core module involving three-carbon compounds
Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:bpq00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    BPC006_I1340
   01230 Biosynthesis of amino acids
    BPC006_I1340
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    BPC006_I1340
   00051 Fructose and mannose metabolism
    BPC006_I1340
   00562 Inositol phosphate metabolism
    BPC006_I1340
  Energy metabolism
   00710 Carbon fixation in photosynthetic organisms
    BPC006_I1340
Enzymes [BR:bpq01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.1  triose-phosphate isomerase
     BPC006_I1340
Exosome [BR:bpq04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   BPC006_I1340
  Exosomal proteins of bladder cancer cells
   BPC006_I1340
  Exosomal proteins of melanoma cells
   BPC006_I1340
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
I:1300723..1301523
Genome map
AA seq 266 aa AA seqDB search
MNTTPGFGASTTRQTMSKQRIKRVIGNWKMHGRLSGNEALLDEVAQGAQAVPEHVGIGVC
VPFPYLAQARARLHGGRVAWGAQDVSAHEQGAFTGEVAAGMVAEFGAAYAIVGHSERRAY
HGESNEIVAAKAQRALAAGLTPVVCVGETLAEREAGATEQVVGVQLDAVLAVLSQDEAAR
IVVAYEPVWAIGTGRSATAEQAQQVHAFLRGRLAAKGAERVSLLYGGSVKADNAAELFGQ
PDIDGGLIGGASLKSGDFLAICRAAQ
NT seq 801 nt NT seq  +upstreamnt  +downstreamnt
atgaacacgacgcccggcttcggcgcgtccacgacgagacaaacgatgtcgaaacaaaga
atcaagcgggtgatcggcaactggaagatgcacggccgcctgagcggcaacgaggcgctg
ctcgacgaagtcgcgcagggcgcgcaagccgtgcccgagcacgtcggcatcggcgtgtgc
gtgccgtttccgtatctcgcgcaggcgcgggcccggcttcacggcggtcgcgtcgcgtgg
ggcgcgcaggacgtgtccgcgcacgagcagggcgcctttaccggcgaagtcgcggccggc
atggtcgcggagttcggcgcggcgtacgcgatcgtcgggcactcggagcgccgcgcgtat
cacggcgaatcgaacgagatcgtcgcggcgaaggcgcaacgtgcgctcgccgcggggctg
acgcccgtcgtgtgcgtcggcgagacgctcgccgagcgcgaagcgggggcgaccgagcag
gtcgtcggcgtgcagctcgacgcggtgctcgcggtgctgtcgcaggacgaggcggcgcgc
atcgtcgtcgcgtacgagcccgtatgggcgatcggcacgggccgcagcgcgacggcggag
caggcgcagcaggtgcacgcgttcctgcgcgggcggctcgcggcgaagggcgccgagcgc
gtgtcgctgctgtatggcggcagcgtgaaggccgacaacgcggccgagctgttcggccag
cctgacatcgacggcggcctgatcggcggcgcgtcgttgaagagcggggatttcctggcg
atttgccgggcggcgcagtaa

DBGET integrated database retrieval system