KEGG   Burkholderia pseudomallei BPC006: BPC006_I1436Help
Entry
BPC006_I1436      CDS       T02301                                 

Definition
exodeoxyribonuclease V subunit alpha
Orthology
K03581  
exodeoxyribonuclease V alpha subunit [EC:3.1.11.5]
Organism
bpq  Burkholderia pseudomallei BPC006
Pathway
Homologous recombination
Brite
KEGG Orthology (KO) [BR:bpq00001]
 Genetic Information Processing
  Replication and repair
   03440 Homologous recombination
    BPC006_I1436
Enzymes [BR:bpq01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.11  Exodeoxyribonucleases producing 5'-phosphomonoesters
    3.1.11.5  exodeoxyribonuclease V
     BPC006_I1436
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
I:1399799..1402465
Genome map
AA seq 888 aa AA seqDB search
MVDERFAWTGGLADRLPEPADFGLALAEGFARRIGMLSRRVGASAAAARWAARAAFAASR
ATAAGHVCVALRALAQRYDEPYDDVRAALAASGVTAFDGIVRGGECPLVVDRDGRLYLAR
YFEYETRLANALVERSRCGGAPAGGADALSPDALGERLVRYFGPQKERGVDWQRVAALIA
LTGRVTIVSGGPGTGKTTTVVGVIACLLDAHPELRIALAAPTGKAAQRMQEALHARAGSL
PAELAARLPRTSCTLHRLLGGGPGGRFAHHRDNPLPYDLVVVDEASMIDVALAAHLLAAL
APNARLVLLGDKDQLAAVEAGAVFAELSARPAFSPATCATIARALGVGEAEFVAALPDGF
VVQAAGAERVADARAAAADMDAAARGTAGAAAAAARATAAAAARMTTAAAAARGAAPAPH
AGRRGGGRASNRTVDDAQGSLFAFDDDAFGVGTSGGEPGAGAQGAGRRDGGAPSLDGPHA
GHRDGGASPGVAHSRRDAFDARARSGPADVSDLENAARAYAPAGAAGPADSPADASFVEP
AAWIEADELAWLDNAVFSFSEGASANAEADGRRSAAATATDADARTAPPVAREATAPTPR
ETARSDGSAVAPLTDCVVWLERNYRFGLDSPIGRLSLAIRRGAVQDALDALSTQDDAAAR
FSDDGGATLSAATVEQLARGFAGYAAALRDALATPEPDALPLFDVLNRFRVLCATRTGAR
GAEEVNARMAAEVRRAVRVPLALGAHWFAGRPVMVTRNDYALGLFNGDIGIALPGARGAL
RVWFRGADGRARAVSPAALPPHDTAFALTVHKSQGSEFDDAALILPASFNRVLSRELVYT
AITRARARVQVIGSRAVLALAIATRTARDSGLAARIADALRARQEGAR
NT seq 2667 nt NT seq  +upstreamnt  +downstreamnt
gtggtcgacgaacgtttcgcgtggacgggcggcctggcggaccgtctgcccgagccggcc
gatttcgggctcgcgctcgccgaaggcttcgcgcgccggatcgggatgctgtcgcggcgt
gtcggcgcgagcgccgcggccgcgcgctgggcggcacgcgcggcgttcgccgcgagccgc
gcgacggcggcggggcacgtatgcgtcgcgctgcgcgcgctcgcgcagcgctacgacgag
ccgtacgacgacgtacgcgcggcgctcgccgcgagcggcgtgaccgcgttcgacggcatc
gtgcgcggcggcgagtgcccactcgtcgtcgatcgcgatggtcggctgtatctcgcgcgc
tacttcgaatacgagacgcggctcgcgaacgcgctcgtcgagcggagccgatgcggcggc
gcgccggcgggcggcgccgatgcgctctcgcccgacgcgctcggcgagcggctcgtccgc
tatttcgggccgcagaaggagcggggcgtcgattggcagcgcgttgcggcgctcatcgcg
ctcacgggccgcgtgacgatcgtgagcggcgggccgggcaccggcaagacgacgacggtc
gtcggcgtgatcgcgtgcctgctcgatgcgcatccggagttgcggatcgcgcttgccgcg
cccaccggcaaggccgcgcagcggatgcaggaggcgctgcacgcgcgcgccggcagcctg
ccggcggaactcgcggcgcgcctgccgcgcacgtcctgcacgctgcaccggctgctgggc
ggtggcccgggcgggcgcttcgcgcaccaccgcgacaatccgctgccgtacgatctcgtc
gtcgtcgacgaggcttcgatgatcgacgtcgcgctcgccgcgcatttgctcgccgcgctc
gcgccgaacgcgcgcctcgtgctgctcggcgacaaggatcagctcgcggccgtcgaggcg
ggcgcggtgttcgccgagctgagcgcgcgtcccgcgttcagcccggcgacgtgcgcgacg
atcgcgcgcgcgctcggcgtcggcgaggccgagttcgtggcggcgctgccggacgggttc
gtcgtgcaggcggccggcgcggagcgcgtggcggacgcgcgtgcggcggcggccgatatg
gacgcggccgcgcgcgggacggccggcgccgcggctgcggccgcacgagcgaccgcggcc
gcagccgcacgaatgaccacggccgcagccgcggcgaggggggccgcgccggcgccgcac
gcgggccggcgtggcggcgggcgcgcatcgaatcggaccgtcgacgatgcgcagggatcg
ttgttcgcgttcgacgacgacgcattcggtgtgggcacgtcgggcggcgagccgggggcc
ggcgcgcaaggtgccgggaggcgagatggcggggcgccgagcctcgacgggccgcacgcc
gggcatcgggacggcggcgcatcgcccggcgtcgcgcacagccggcgcgatgcgttcgac
gcgcgtgcccggtcgggtccggcggatgtttccgacctggaaaacgccgcgcgcgcgtac
gcgccggcgggcgcagccggcccggccgattcgccggcggacgcgtctttcgtcgagccg
gccgcctggatcgaagcggacgaactcgcgtggctcgacaacgcggtcttttcgttctcc
gaaggcgcttcggcgaatgccgaagccgacgggcggcgaagcgccgcggcgacggcgacc
gacgcggacgcgcgcaccgcgccgccggttgcgcgggaagcgacggcgccgacgccgcgc
gagaccgcgcgatcggacggttccgccgtcgcgccgctgaccgactgcgtcgtctggctt
gaacgcaactatcgcttcggccttgattcgccgatcggccggctgtcgcttgcgattcgc
cgcggcgcggtgcaggacgcgctcgacgcgctatcgacgcaagacgacgcggccgcgcgt
tttagcgacgacggcggtgcgacgctgtcggccgcgacggtcgagcagctcgcgcgaggc
ttcgccggctatgcggccgcgctgcgcgacgcgctggcgacgcccgaacccgatgcgctg
ccgctcttcgacgtgctcaaccgctttcgcgtgctttgcgcgacgcgcacgggcgcgcgc
ggcgcggaggaagtcaacgcgcgcatggcggccgaggtgcgccgcgcggtgcgcgtgccg
ctcgcgctcggtgcgcactggttcgccggacggcccgtgatggtgacgcgcaacgattac
gcgctcggcctcttcaacggcgacatcggcattgcgctgcccggcgcgcgcggtgcgctg
cgcgtctggtttcgcggcgcggacggccgcgcccgggcggtgtcgcccgccgcgctgccg
ccgcacgacacggcgttcgcgctgaccgtccacaaatcgcagggctcggaattcgacgac
gcggcactgatcctgcccgcgtcgttcaatcgcgtgctgtcgcgcgaactcgtctacacc
gcgatcacgcgcgcgcgcgcgcgcgtgcaggtgatcggctcgcgcgcggtgctcgcgctc
gcgatcgcgacgcgcacggcgcgcgattccggccttgccgcacgaatcgccgatgcgctg
cgcgcgcggcaggagggcgcgcgatga

DBGET integrated database retrieval system