KEGG   Burkholderia pseudomallei BPC006: BPC006_I1613Help
Entry
BPC006_I1613      CDS       T02301                                 

Definition
glycogen branching protein
Orthology
K00700  
1,4-alpha-glucan branching enzyme [EC:2.4.1.18]
Organism
bpq  Burkholderia pseudomallei BPC006
Pathway
Starch and sucrose metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:bpq00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    BPC006_I1613
Enzymes [BR:bpq01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.18  1,4-alpha-glucan branching enzyme
     BPC006_I1613
Exosome [BR:bpq04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   BPC006_I1613
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
I:complement(1549637..1551853)
Genome map
AA seq 738 aa AA seqDB search
MTDAPFDRADIDALLDARHPDPFACLGPHRVGDATVVRTLLPGALRVRAIAAGGGVLGEL
RQVDPAGCFAGALPDGRERGERPRYRLSIDWPDARQDVEDAYAFGTLLDEDALARFAAGD
PRAALACLGARALDMDGVPGVRFAVWAPGASRVSVVGDFNGWDARRHPMRLRRPWGVWEL
FVPRIGAGERYKFALRARDGAALPLKADPCACRTEAPPRTASIVADLDALERFGWHDDAW
LRARASLDLAHAPVSIYEVHPESWLRVAAEGNRSATWDELAQRLIPYAAGMGFSHVELTP
IAEYPFGGSWGYQSLSPFAPSARFGPPEGFARFVEHAHAAGLGVIVDWVPAHFPDDPHGL
GKFDGTALFEHADPREGWHPDWHTHVFNVGRREVGAFLIASALAWAHRYHVDGIRVDAVA
SMLYRDYSRAAGEWVPNVYGGRENLESIAFLKHFNDTLHGPAAPPGVATFAEESTAWPGV
TAPTAEHGLGFDFKWNMGWMHDTLAYLREDPIHRRHHHDRLTFGLVYAFSERFVLPLSHD
EVVHGKGSLAAKMPGDAWQRLANLRAYFGFMWAHPGKKLLFMGGEFAQWGEFAHDATPQW
DLLDAPAHRGVQRLVRDLNRLHAAEPALHALDDRPAGFAWLVGDDRNNSVFAFVRRDDAG
RMLVAVCNFTPVPRTDYRLGLPAPGRWAEVLNTDGAAYGGTDAGNGGALQADEIPAHGER
WSAALRLPPLATLWLRPA
NT seq 2217 nt NT seq  +upstreamnt  +downstreamnt
atgacggatgcgcccttcgatcgcgccgacatcgacgcgctcctcgacgcgcgccatccg
gacccgttcgcgtgcctcggcccgcaccgcgtcggcgacgcgacggtcgtgcgcacgctg
ctgcccggcgcgctgcgggttcgcgcgatcgcggcgggcggcggcgtgctcggcgagctg
cggcaggtcgatccggccggctgcttcgccggcgcgctgcccgatgggcgggaacgcggc
gagcggccgcgctatcggctgtcgatcgactggcccgacgcgcgacaggacgtggaggac
gcgtatgcgttcggcacgctgctcgacgaggatgcgctcgcgcgcttcgcggcgggcgat
ccgcgcgcggcgctcgcgtgcctcggcgcgcgcgcgctcgacatggatggcgtgcccggc
gtgcggttcgccgtctgggcgccgggcgcgtcgcgcgtgtcggtggtcggcgatttcaac
ggctgggatgcgcgccgccacccgatgcggctgcgccgcccgtggggcgtgtgggagctg
ttcgtgccgcgcatcggcgcgggcgagcgctacaagttcgcgctgcgcgcgcgcgacggc
gccgcgctgccgctgaaggccgacccgtgcgcgtgccgcaccgaggcgccgccgcgcacc
gcgtcgatcgtcgccgatctcgacgcgctcgagcgcttcggctggcacgacgacgcgtgg
ctgcgcgcgcgcgcgtcgctcgatctcgcgcacgcgccggtgtcgatctacgaagtccat
ccggaatcgtggctgcgcgtcgcggccgagggcaatcgcagcgcgacgtgggacgagctc
gcgcagcggctgattccgtatgcggccggcatgggcttctcgcacgtcgagctcacgccg
atcgccgagtatccgttcggcggctcgtggggctaccagtcgctatcgccgttcgcgccg
tccgcgcggttcgggccgccggaaggcttcgcgcgcttcgtcgagcacgcgcacgcggcc
ggcctcggcgtgatcgtcgactgggtgcccgcgcactttcccgacgatccgcacgggctc
ggcaaattcgacggcaccgcgctgttcgagcatgcggacccgcgcgagggatggcatccg
gactggcacacgcacgtgttcaacgtcgggcggcgcgaagtcggcgcgttcctgatcgcg
tcggcgctcgcgtgggcgcaccgctatcacgtcgacggcattcgcgtcgacgccgtcgcg
tcgatgctctaccgcgactactcgcgcgcggcgggcgaatgggtgccgaacgtgtacggc
gggcgcgagaacctcgaatcgatcgcgttcctgaagcacttcaacgacacgctgcacggg
cccgccgcgccgcccggcgtcgcgacgttcgcggaggaatcgaccgcatggcccggcgtc
accgcgccgaccgccgagcacggcctcggcttcgatttcaagtggaacatgggctggatg
cacgacacgctcgcctatctgcgcgaggacccgatccatcgccgccatcaccacgaccga
ctcacgttcgggctcgtctatgcgttctccgagcgcttcgtgctgccgctgtcgcacgac
gaagtcgtgcacggcaagggctcgctcgcggccaagatgccgggcgacgcctggcagcgc
ctcgcgaacctgcgcgcgtacttcggcttcatgtgggcgcatccgggcaagaagctgctg
ttcatgggcggcgagttcgcgcagtggggggagttcgcgcacgacgcgacgccgcagtgg
gatctgctcgacgcgcccgcgcaccggggcgtgcagcgcctcgtgcgcgacctgaaccgg
ctgcatgcggccgagccggcgctgcacgcgctcgacgaccggcccgccgggttcgcgtgg
ctcgtcggcgacgatcgcaacaacagcgtgttcgcgttcgtccgtcgcgacgatgcgggc
cgcatgctcgtcgcggtgtgcaacttcacgccggtgccgcgcaccgactatcggctcggg
ctgcccgcgccgggccgctgggccgaggtgctgaacaccgacggcgccgcatacggcggc
accgacgcgggcaacggcggcgcgctccaagccgacgagattcccgcgcacggcgagcga
tggtcggccgcgctgcgcctgccgccgctcgcgacgctatggctgcgccccgcctga

DBGET integrated database retrieval system