KEGG   Burkholderia pseudomallei BPC006: BPC006_I1693Help
Entry
BPC006_I1693      CDS       T02301                                 

Definition
di-heme cytochrome c peroxidase
Orthology
K00428  
cytochrome c peroxidase [EC:1.11.1.5]
Organism
bpq  Burkholderia pseudomallei BPC006
Brite
Enzymes [BR:bpq01000]
 1. Oxidoreductases
  1.11  Acting on a peroxide as acceptor
   1.11.1  Peroxidases
    1.11.1.5  cytochrome-c peroxidase
     BPC006_I1693
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
I:1632611..1634026
Genome map
AA seq 471 aa AA seqDB search
MMRRLPRYARQHRSFFVAPRAFAAAAALAAGVAACDANGPGAGAAAAVAPAALAVPAASA
ASAASAARPAPLAQPAAPAVVDSQPQTRAQVYEAVKQMTALGRQLFFDPSLSGSGKLACA
SCHSPQHAFGPPNALPAQFGGDDLRQQGFRAVPTLKYLQKVPAFSEHYHESDDEGDESVD
AGPTGGLTWDGRADSGAEQARAPLTSPFEMNGTPEKVARAVRAAPYAPAFRAAFGARVLD
DDRATFEAVLQALGTFEQVPDVFYPYTSKYDAYLAGRARLTRAELHGLQVFNDEKKGNCA
SCHVSRRGLDGSPPQFSDFGLIALGVPRNRALAVNRNPNFYDLGACGPERRDLKGRDEFC
GLFRTPTLRNVALKKTFFHNGVYHSLDDVLRFYAERDTHPEKFYPVKRGVVQKFDDLPKR
YWKNLNDEPPFERKRGDPPAMTDAEIRDVIAFLGTLTDGYDPRAKPAGGAR
NT seq 1416 nt NT seq  +upstreamnt  +downstreamnt
atgatgcgccgcttgccgcgatacgcccgccagcaccgttcgttcttcgtcgcgccgcgc
gcgttcgcggcggccgccgcgcttgccgcgggcgtcgccgcgtgtgacgcgaacgggccg
ggcgcgggcgccgccgcggccgtcgcgcccgctgcgctcgctgtcccagccgcctccgct
gcctccgctgcctccgctgcgcgtcccgcgcctctcgcgcagccggccgcgcccgccgtc
gtcgacagtcagccgcagacgcgcgcgcaggtgtacgaggcggtcaagcagatgacggcg
ctcggcaggcagttgttcttcgatccttcgctgtcgggcagcggcaagctcgcctgcgcg
tcgtgccacagcccgcagcacgcgttcgggccgccgaacgcgttgcccgcgcaattcggc
ggcgacgatctgcgccagcagggctttcgcgccgtgccgacgctcaaatacctgcagaag
gtgcccgcgttcagcgagcactatcacgaatcggacgacgagggcgacgagagcgtcgac
gccggcccgacgggcgggctcacgtgggacggccgcgcggacagcggcgccgagcaggcg
cgcgcgccgctcacgtcgccgttcgagatgaacggcacgcccgagaaggtcgcgcgcgcg
gtgcgggccgcgccgtacgcgcccgcgtttcgcgcggcgttcggcgcgcgcgtgctcgac
gacgaccgcgcgacgttcgaggcggtgctgcaggcgctcggcacgttcgagcaggtgccc
gacgtgttctatccgtacacgagcaagtacgacgcgtacctggcgggccgcgcgcggttg
acgcgcgccgagctgcacgggctgcaggtcttcaacgacgagaagaagggcaactgcgcg
agctgccacgtgagccggcgcgggctcgacggctcgccgccgcagttcagcgatttcggc
ctgatcgcgctcggcgtgccgcgcaatcgcgcgctcgcggtgaatcggaatccgaatttt
tacgacctcggcgcatgcgggcccgagcgccgggacctgaaggggcgcgacgagttctgc
gggctgttccgcacgccgacgctgcgtaacgtcgcgctgaagaagacgttcttccacaac
ggcgtctatcactcgctcgacgacgtgctgcgcttctacgccgagcgcgacacgcatccg
gagaagttctatccggtgaagcgcggcgtcgttcagaagttcgacgacttgccgaagcgc
tactggaagaacctgaacgacgagccgccgttcgagcgcaagcgcggcgatccgcccgcg
atgaccgatgcggagatccgggacgtgatcgcgttcctcggcacgctcaccgacggctac
gatccgcgcgcgaagccggcaggcggcgcgcgctga

DBGET integrated database retrieval system