KEGG   Burkholderia pseudomallei BPC006: BPC006_I1823Help
Entry
BPC006_I1823      CDS       T02301                                 

Definition
dihydrolipoamide succinyltransferase
Orthology
K00658  
2-oxoglutarate dehydrogenase E2 component (dihydrolipoamide succinyltransferase) [EC:2.3.1.61]
Organism
bpq  Burkholderia pseudomallei BPC006
Pathway
Citrate cycle (TCA cycle)
Lysine degradation
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Citrate cycle (TCA cycle, Krebs cycle)
Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:bpq00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    BPC006_I1823
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    BPC006_I1823
  Amino acid metabolism
   00310 Lysine degradation
    BPC006_I1823
Enzymes [BR:bpq01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.61  dihydrolipoyllysine-residue succinyltransferase
     BPC006_I1823
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
I:1767871..1769079
Genome map
AA seq 402 aa AA seqDB search
MLQWKKKPGEAVAQDEILIELETDKVVLEVPAPAAGVLAQVLQNDGDTVVADQVIATIDT
EAKAGAAAAAAGAADVQPAAAPVAAPAPAAQPAAAAASSTAAASPAASKLMAEKGIGAGD
VAGSGRDGRITKGDVLSAGSAPAAAPAKAAAKPALPEVKVPASATTWLNDRPEQRVPMSR
LRARIAERLLESQQTNAILTTFNEVNMQPVMDLRAKYKDKFEKEHGVKLGFMSFFVKAAV
HALKKFPLVNASIDGNDIVYHGYFDIGIAVGSPRGLVVPILRNADQLSLAEIEKKIAEFG
QKAKDGKLSIEEMTGGTFSISNGGVFGSMLSTPIINPPQSAILGVHATKERPVVENGQIV
IRPINYLALSYDHRIIDGREAVLSLVAMKDALEDPARLLLDL
NT seq 1209 nt NT seq  +upstreamnt  +downstreamnt
atgctgcagtggaagaagaagcccggcgaagccgtcgcgcaggacgaaatcctgatcgag
ctcgagacggacaaggtcgtcctcgaagtgccggcgccggccgcgggcgtgctcgcgcag
gtgctgcagaacgacggtgacacggtcgtcgccgaccaggtgatcgcgaccatcgacacc
gaagcgaaggcaggcgccgccgcggcagcggcaggcgccgccgacgttcagccggccgcc
gctcccgtcgccgcgccggcgcccgccgcacagccggccgccgccgccgcgtcgagcacc
gcggccgcatcgcccgccgcgtcgaagctgatggccgagaagggcatcggcgccggcgac
gtcgccggctcgggccgcgacggccgcatcacgaagggcgacgtgctgtccgcgggcagc
gcgccggccgccgcgccggcgaaggccgccgcgaagccggcgctgccggaagtgaaggtg
ccggcatcggcgacgacgtggctcaacgaccgtccggagcagcgcgtgccgatgtcgcgc
ctgcgcgcgcgcatcgccgagcgtctgctcgaatcgcagcagaccaacgcgatcctcacg
acgttcaacgaagtgaacatgcagccggtgatggacctgcgcgcgaagtacaaggacaag
ttcgagaaggagcacggcgtgaagctcggcttcatgtcgttcttcgtgaaggcggccgtt
cacgcgctgaagaagttcccgctcgtgaacgcgtcgatcgacggcaacgacatcgtctac
cacggctacttcgacatcggcatcgcggtcggttcgccgcgcggcctcgtcgtgccgatc
ctgcgcaacgcggatcagctgagcctcgccgagatcgagaagaagatcgccgaattcggc
cagaaggcaaaggacggcaagctgtcgatcgaggaaatgacgggcggcacgttctcgatc
tcgaacggcggcgtgttcggctcgatgctgtcgacgccgatcatcaacccgccgcagtcg
gcgatcctcggcgtgcacgcgacgaaggagcgcccggtcgtcgagaacggccagatcgtg
atccgcccgatcaactatctcgcgctgtcgtacgaccaccggatcatcgacggtcgcgaa
gcggtgctgtcgctcgtcgcgatgaaggacgcgctcgaagatccggcgcgcctgctgctc
gacctgtaa

DBGET integrated database retrieval system