KEGG   Burkholderia pseudomallei BPC006: BPC006_I1823Help
Entry
BPC006_I1823      CDS       T02301                                 

Definition
(GenBank) dihydrolipoamide succinyltransferase
  KO
K00658  2-oxoglutarate dehydrogenase E2 component (dihydrolipoamide succinyltransferase) [EC:2.3.1.61]
Organism
bpq  Burkholderia pseudomallei BPC006
Pathway
bpq00020  Citrate cycle (TCA cycle)
bpq00310  Lysine degradation
bpq01100  Metabolic pathways
bpq01110  Biosynthesis of secondary metabolites
bpq01120  Microbial metabolism in diverse environments
bpq01130  Biosynthesis of antibiotics
bpq01200  Carbon metabolism
Module
bpq_M00009  Citrate cycle (TCA cycle, Krebs cycle)
bpq_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:bpq00001]
 Metabolism
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    BPC006_I1823
  Amino acid metabolism
   00310 Lysine degradation
    BPC006_I1823
Enzymes [BR:bpq01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.61  dihydrolipoyllysine-residue succinyltransferase
     BPC006_I1823
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 2-oxoacid_dh Biotin_lipoyl E3_binding Biotin_lipoyl_2
Motif
Other DBs
NCBI-ProteinID: AFR15697
Position
I:1767871..1769079
Genome map
AA seq 402 aa AA seqDB search
MLQWKKKPGEAVAQDEILIELETDKVVLEVPAPAAGVLAQVLQNDGDTVVADQVIATIDT
EAKAGAAAAAAGAADVQPAAAPVAAPAPAAQPAAAAASSTAAASPAASKLMAEKGIGAGD
VAGSGRDGRITKGDVLSAGSAPAAAPAKAAAKPALPEVKVPASATTWLNDRPEQRVPMSR
LRARIAERLLESQQTNAILTTFNEVNMQPVMDLRAKYKDKFEKEHGVKLGFMSFFVKAAV
HALKKFPLVNASIDGNDIVYHGYFDIGIAVGSPRGLVVPILRNADQLSLAEIEKKIAEFG
QKAKDGKLSIEEMTGGTFSISNGGVFGSMLSTPIINPPQSAILGVHATKERPVVENGQIV
IRPINYLALSYDHRIIDGREAVLSLVAMKDALEDPARLLLDL
NT seq 1209 nt NT seq  +upstreamnt  +downstreamnt
atgctgcagtggaagaagaagcccggcgaagccgtcgcgcaggacgaaatcctgatcgag
ctcgagacggacaaggtcgtcctcgaagtgccggcgccggccgcgggcgtgctcgcgcag
gtgctgcagaacgacggtgacacggtcgtcgccgaccaggtgatcgcgaccatcgacacc
gaagcgaaggcaggcgccgccgcggcagcggcaggcgccgccgacgttcagccggccgcc
gctcccgtcgccgcgccggcgcccgccgcacagccggccgccgccgccgcgtcgagcacc
gcggccgcatcgcccgccgcgtcgaagctgatggccgagaagggcatcggcgccggcgac
gtcgccggctcgggccgcgacggccgcatcacgaagggcgacgtgctgtccgcgggcagc
gcgccggccgccgcgccggcgaaggccgccgcgaagccggcgctgccggaagtgaaggtg
ccggcatcggcgacgacgtggctcaacgaccgtccggagcagcgcgtgccgatgtcgcgc
ctgcgcgcgcgcatcgccgagcgtctgctcgaatcgcagcagaccaacgcgatcctcacg
acgttcaacgaagtgaacatgcagccggtgatggacctgcgcgcgaagtacaaggacaag
ttcgagaaggagcacggcgtgaagctcggcttcatgtcgttcttcgtgaaggcggccgtt
cacgcgctgaagaagttcccgctcgtgaacgcgtcgatcgacggcaacgacatcgtctac
cacggctacttcgacatcggcatcgcggtcggttcgccgcgcggcctcgtcgtgccgatc
ctgcgcaacgcggatcagctgagcctcgccgagatcgagaagaagatcgccgaattcggc
cagaaggcaaaggacggcaagctgtcgatcgaggaaatgacgggcggcacgttctcgatc
tcgaacggcggcgtgttcggctcgatgctgtcgacgccgatcatcaacccgccgcagtcg
gcgatcctcggcgtgcacgcgacgaaggagcgcccggtcgtcgagaacggccagatcgtg
atccgcccgatcaactatctcgcgctgtcgtacgaccaccggatcatcgacggtcgcgaa
gcggtgctgtcgctcgtcgcgatgaaggacgcgctcgaagatccggcgcgcctgctgctc
gacctgtaa

DBGET integrated database retrieval system