KEGG   Burkholderia pseudomallei BPC006: BPC006_I2161Help
Entry
BPC006_I2161      CDS       T02301                                 

Definition
nitrous-oxide reductase
Orthology
K00376  
nitrous-oxide reductase [EC:1.7.2.4]
Organism
bpq  Burkholderia pseudomallei BPC006
Pathway
Nitrogen metabolism
Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:bpq00001]
 Metabolism
  Energy metabolism
   00910 Nitrogen metabolism
    BPC006_I2161
Enzymes [BR:bpq01000]
 1. Oxidoreductases
  1.7  Acting on other nitrogenous compounds as donors
   1.7.2  With a cytochrome as acceptor
    1.7.2.4  nitrous-oxide reductase
     BPC006_I2161
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
I:2137490..2139565
Genome map
AA seq 691 aa AA seqDB search
MSQCGANRHRPARITGIESGNGPLPGVENESMSENVMANSKENTEAAAAPQDARRRRFLA
SSAVAGLAGASLSLGLAGCNKGGDAPASASGAGASAASGAGAAPAIDFGKYEVHPGKLDT
YYTFSSGGHSGDIRVHGLPSGREIRRIPVYNIDCMSGWGITNESRKIIGTKANGQLEYFT
GDTHHVHMSYTDGTYDGKYIFVNDKINARIARVRLDTMECDAITPLPNVQGFHGIFPDKR
DPLDQTINYTTRVFCGNEFHIPHPNDGRDLNDPKKYYCLFTCVDAKTMQPRWQVKIDGNM
DLVATSYDGKLACSNQYNTENGVHYEEMMAAERDACVFFNVARIEEAVKNGKFFKVGNSP
VPVVDGTRAANADPKTALTCYVSVPKNPHGVNASPDGKYYACSGKLSPTATLISHELMLK
WFAGELKEPRDAVVAEPEIGLGPLHTGFDGKGYAYTTLFLDSQIVKWSLEEAIKAYKGEK
AAKVVVDRIDVHYQPGHGFTSMGETKEPDGQFFISDNKFSKDRYLPVGPLHPDSAQLIDI
SGEKMLLVADHPTYPEPHDSIVVRRDIIKTRQIYNLDEFPLAVKNAKDSRVERHGRKVTV
YLTSQAPTFGLREWTVKKGDEVTIILTNLDKVEDLTHGFAIPFYNINFVVHPQQTQSVTF
IADKPGVFWCFCTNFCHALHLEMRSRMLVEA
NT seq 2076 nt NT seq  +upstreamnt  +downstreamnt
ttgtcgcaatgcggcgcaaatcgtcaccggccagcccggattaccggcatcgaaagcggg
aacgggccgttgcccggcgtggaaaacgaatcaatgagtgagaatgtgatggctaattcg
aaggaaaacaccgaagcggcggcagcgccgcaggacgcgcggcggcgcaggttcctcgcc
tcgtcggcggtcgcggggctcgcgggcgcgagcctgtcgctcggcctcgcgggctgcaac
aagggcggcgacgcgcccgcctcggcgagcggcgcgggcgcgagcgcggcgagcggcgcg
ggtgcggcccccgcaatcgacttcggcaagtacgaagtgcatccgggcaagctcgatacg
tactacacgttctcgagcggcggccattcgggcgacatccgcgtgcacggcctgccgtcc
gggcgcgagatccggcgcattcccgtctacaacatcgactgcatgtccggctggggcatc
acgaacgaatcgcgcaagatcatcggcaccaaggccaacggccagctcgaatacttcacg
ggcgacacgcaccacgtgcacatgtcctatacggacggcacgtacgacggcaagtacatc
ttcgtgaacgacaagatcaatgcgcgcatcgcgcgcgtgcgcctcgacacgatggagtgc
gacgcgatcacgccgctaccgaacgtgcagggctttcacggcatcttccccgacaagcgc
gatccgctcgaccagacgatcaactacacgacgcgcgtgttctgcggcaacgagttccac
attccgcacccgaacgacggccgcgacctgaacgacccgaagaagtactactgcctgttc
acctgcgtcgacgcgaagacgatgcagccgcgctggcaggtgaagatcgacggcaacatg
gatctcgtcgcgacgtcgtatgacggcaagctcgcgtgctcgaaccagtacaacaccgag
aacggcgtgcattacgaggaaatgatggcggccgagcgcgacgcgtgcgtgttcttcaac
gtcgcgcgcatcgaggaagcggtgaagaacggcaagttcttcaaggtgggcaactcgccc
gtgcccgtcgtcgacggcacgcgcgcggcgaacgccgatccgaagacggccctcacctgc
tacgtgagcgtgccgaagaacccgcacggcgtgaacgcgtcgcccgacggcaagtactac
gcgtgctcgggcaagctctcgcccaccgcgacgctgatctcgcacgagctgatgctcaag
tggttcgcgggcgagctcaaggagccgcgcgacgcggtggtcgcggagccggagatcggc
ctcgggccgctgcataccggcttcgacggcaagggctacgcgtacacgacgctctttctc
gacagccagatcgtcaagtggagcctcgaggaagcgatcaaggcgtacaagggcgagaag
gcggcgaaagtcgtcgtcgaccggatcgacgtgcactaccagccgggccacggcttcacg
tcgatgggcgagacgaaggagccggacggccagttcttcatctcggacaacaagttctcg
aaggaccgctacctgcccgtcgggccgctgcatccggacagcgcgcagttgatcgacatc
agcggcgagaagatgctgctcgtggccgaccatccgacgtatcccgagccgcacgactcg
atcgtcgtgcgccgcgacatcatcaagacacggcagatctacaacctcgacgagttcccg
ctcgcggtgaagaacgcgaaggacagccgcgtcgagcggcacggcaggaaggtcaccgtc
tacctgacgtcgcaggcgccgaccttcgggctgcgcgaatggaccgtgaagaaaggcgac
gaggtcacgatcatcctgaccaacctcgacaaggtggaggacctgacgcacggcttcgcg
atcccgttctacaacatcaacttcgtcgtgcatccgcagcagacgcagtcggtgacgttc
atcgcggacaagcccggcgtgttctggtgcttctgcacgaacttctgccacgcgctgcat
ctggagatgcgctcgcggatgctcgtcgaggcgtag

DBGET integrated database retrieval system