KEGG   Burkholderia pseudomallei BPC006: BPC006_I2311Help
Entry
BPC006_I2311      CDS       T02301                                 

Definition
threonine synthase
Orthology
K01733  
threonine synthase [EC:4.2.3.1]
Organism
bpq  Burkholderia pseudomallei BPC006
Pathway
Glycine, serine and threonine metabolism
Vitamin B6 metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of amino acids
Module
Threonine biosynthesis, aspartate => homoserine => threonine
Brite
KEGG Orthology (KO) [BR:bpq00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    BPC006_I2311
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    BPC006_I2311
  Metabolism of cofactors and vitamins
   00750 Vitamin B6 metabolism
    BPC006_I2311
Enzymes [BR:bpq01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.3  Acting on phosphates
    4.2.3.1  threonine synthase
     BPC006_I2311
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
I:complement(2283958..2285409)
Genome map
AA seq 483 aa AA seqDB search
MNYISTRGAGIGERHTFSDILLGGLAKDGGLYLPSEYPRVSADELARWRALPYADLAFEI
LAKFCDDIPADDLRAITRRTYTADVYRHTRHGGNAADITPLTTLGAENGAPVSLLELSNG
PTLAFKDMAMQLLGNLFEYTLAAHGETLNILGATSGDTGSAAEYAMRGKRGVRVFMLSPH
RKMSAFQTAQMYSLQDPNIFNLAVKGVFDDCQDIVKAVSNDHAFKAQQKIGTVNSINWAR
VVAQVVYYFKGYFAATRTNDERVSFTVPSGNFGNVCAGHIARMMGLPIEKLVVATNENDV
LDEFFRTGAYRVRSAEHTYHTSSPSMDISKASNFERFVFDLLGRDPARVVQLFRDVEQKG
GFDLAASGDFARVAEFGFVSGRSTHADRLATIRDVFERYRTTIDTHTADGLKVAREHLQP
GVPMIVLETAQPIKFGETIREALGQEPSRPAAFDGLEALPQRFEVVDASAQQVKDFIAAH
TGA
NT seq 1452 nt NT seq  +upstreamnt  +downstreamnt
atgaattacatctccacgcgcggcgccggcatcggcgagcgtcacacgttctccgacatc
ctgctcggcggcctcgcgaaggacggcgggctctacctgccgagcgagtatccgcgggtg
agcgcggacgagctcgcgcgctggcgcgcgctgccgtacgcggatctcgcgttcgagatc
ctcgcgaagttctgcgacgacatcccggccgacgacctgcgcgcgatcacgcgccgcacg
tatacggccgacgtctatcgtcacacgcgccacggcggcaacgcggccgacatcacgccg
ctcacgacgctcggcgccgagaacggcgcgccggtctcgctgctcgaactgtcgaacggc
ccgacgctcgcgttcaaggacatggcgatgcagttgctcggcaacctgttcgagtacacg
ctcgccgcgcacggcgaaacgctgaacatcctcggcgcgacgtcgggcgatacgggcagc
gcggccgaatacgcgatgcgcggcaagcggggcgtgcgcgtgttcatgctgtcgccgcac
cggaagatgagtgcgttccagacggcccagatgtacagcctgcaggacccgaacatcttc
aacctcgcggtgaagggcgtgttcgacgattgccaggacatcgtgaaggccgtgtcgaac
gatcacgcgttcaaggcgcagcagaagatcggcacggtcaattcgatcaactgggcgcgt
gtcgtcgcgcaggtcgtgtactacttcaagggctatttcgcggcgacgcgcacgaacgac
gagcgcgtgtcgtttacggtgccgtcgggcaacttcggcaatgtctgcgcgggccacatc
gcgcggatgatggggctgccgatcgagaagctcgtcgtcgcgaccaacgagaacgacgtg
ctcgacgaattcttccgcacgggtgcgtatcgcgtgcgcagcgccgagcacacgtaccac
acgagcagcccgagcatggacatctcgaaggcgtcgaacttcgagcgcttcgtgttcgac
ctgctcggccgcgatccggcgcgcgtcgttcagctgtttcgcgacgtcgagcaaaagggt
ggcttcgatctcgcggcgagcggcgatttcgcgcgcgtcgccgagttcggcttcgtgtcg
ggccgcagcacgcacgcggaccggctcgcgacgatccgcgacgtgttcgagcgctatcgc
acgacgatcgacacgcacacggccgacggcctgaaagtggcgcgcgagcatctgcagccg
ggcgtgccgatgatcgtgctcgagaccgcgcagccgatcaagttcggcgaaacgattcgc
gaggcgctcgggcaggagccgtcgcggcccgccgcgttcgacgggctcgaggcgctgccg
cagcgcttcgaggtggtcgacgcgagcgcgcagcaggtgaaggacttcatcgccgcgcac
acgggcgcatga

DBGET integrated database retrieval system