KEGG   Burkholderia pseudomallei BPC006: BPC006_I2392Help
Entry
BPC006_I2392      CDS       T02301                                 

Definition
acyl-CoA thioesterase I
Orthology
K10804  
acyl-CoA thioesterase I [EC:3.1.2.- 3.1.1.5]
Organism
bpq  Burkholderia pseudomallei BPC006
Pathway
Biosynthesis of unsaturated fatty acids
Class
Metabolism; Lipid metabolism; Biosynthesis of unsaturated fatty acids [PATH:bpq01040]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
I:2356295..2356969
Genome map
AA seq 224 aa AA seqDB search
MKRTVHWKAGATLAVVATFAGPASAATNAAPAPNADGGKPVIVVLGDSLSAEYGLPRDTG
WVALMRARLAAERIDYSVANASISGDTTSGGRARLPAVLARLKPAVVVVELGANDALRGV
PLAATEGNLREIVAQARQARAQVLLVGMYVPSNYGPDYTQKFRGVYTGLSKEMRVPLVPF
LLAGIENKPDMFQADQIHPTQAAQRQLLDNVWPALKPLLRTSSR
NT seq 675 nt NT seq  +upstreamnt  +downstreamnt
atgaaacgcacagttcactggaaggccggcgcgacgctcgccgtggtcgcgacgttcgcc
ggcccggcatccgccgccacgaatgcagcgcccgcgccgaacgccgacggcggcaagccg
gtgatcgtcgtgctcggcgacagcctgtcggccgaatacggcctgccgcgcgatacgggc
tgggtcgcgctgatgcgcgcacgcctcgcggccgagcgaatcgattatagcgtcgcgaac
gcgagcatctcgggcgacacgacgagcggcggccgcgcgcggctgcccgcggtgctcgca
cggctcaagccggccgtcgtcgtcgtcgaactcggcgcgaacgacgcgctgcgcggcgtg
ccgctcgccgcgaccgaaggcaacctgcgcgagatcgtcgcgcaggcgcggcaggcgcgc
gcgcaggtgctgctcgtcggcatgtacgtgccgtcgaactacggcccggactacacgcaa
aagttccgcggcgtctacacggggctgtccaaggagatgcgcgtgccgctcgtgccgttc
ctgctcgccggcatcgagaacaagcccgacatgttccaggccgaccagatccatccgacg
caggccgcgcagcgccagttgctcgacaacgtatggccggccctcaagccgctgctgcgg
acgtcatcgcgctga

DBGET integrated database retrieval system