KEGG   Burkholderia pseudomallei BPC006: BPC006_I2818Help
Entry
BPC006_I2818      CDS       T02301                                 

Definition
glutathione S-transferase
Orthology
K00799  
glutathione S-transferase [EC:2.5.1.18]
Organism
bpq  Burkholderia pseudomallei BPC006
Pathway
Glutathione metabolism
Class
Metabolism; Metabolism of other amino acids; Glutathione metabolism [PATH:bpq00480]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
I:2768281..2768724
Genome map
AA seq 147 aa AA seqDB search
MRVDGTRHTETAALLQRIGDLAGAGTLIPAHGTPARYEVIEWLTFVSSELHKTYSPWLFH
ADTADSTRRQCLEKLDRRLQEVDAHLATRDYLTGAFTVADAYLFAVANWSNFLRIPLAPY
PHLVAFMARVGARAKVGEALAAEGLGR
NT seq 444 nt NT seq  +upstreamnt  +downstreamnt
atgcgagtagacggcacgcgccataccgagacggccgcgctgctgcagcgcatcggcgat
ctggcgggcgccggcacgctgattcccgcgcacggcacacccgcgcgctacgaggtgatc
gaatggctgacgttcgtcagctccgagctgcacaagacctacagcccgtggctctttcac
gccgacaccgccgattcgacgcggcggcagtgcctcgagaagctcgatcgccgcctgcag
gaagtcgacgcgcatctcgcgacgcgcgactatctgacgggcgccttcacggtggcggac
gcgtatctgttcgcggtcgcgaactggtcgaacttcctgcgcatcccgctcgcgccgtat
ccgcatctcgtcgcgttcatggcgcgggtgggcgcgcgggcgaaggtcggcgaagcgctc
gcggccgaaggcctcggccgttga

DBGET integrated database retrieval system