KEGG   Burkholderia pseudomallei BPC006: BPC006_I3051Help
Entry
BPC006_I3051      CDS       T02301                                 

Definition
guanylate kinase
Orthology
K00942  
guanylate kinase [EC:2.7.4.8]
Organism
bpq  Burkholderia pseudomallei BPC006
Pathway
Purine metabolism
Metabolic pathways
Module
Guanine ribonucleotide biosynthesis IMP => GDP,GTP
Class
Metabolism; Nucleotide metabolism; Purine metabolism [PATH:bpq00230]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
I:complement(2980159..2980842)
Genome map
AA seq 227 aa AA seqDB search
MTDSNRDGAAAHSLHAGVYPGNLFMVVAPSGAGKSTLVNALLSKDPEIRLSISYTTRKPR
PGEQDGQHYHFTTVEDFRERHARHEFLESAEVHGNYYGTSRVWIEEQMKIGHDVLLEIDW
QGAQQVKKQFRNAVGIFILPPSLAALEERLKKRGQDEPNVITRRLLAAGSEIAHAAEAQY
VVINETFEHALAELECIVAATRLRFTSQYARHAELFVELGIHLPHAE
NT seq 684 nt NT seq  +upstreamnt  +downstreamnt
atgaccgattcgaaccgcgacggcgcagccgcgcattcgctgcacgccggcgtctatccc
ggcaatctcttcatggtcgtcgcgccgtcgggcgcgggcaagtcgacgctcgtcaacgcg
ctgctgtcgaaggacccggagattcgcctgtcgatttcgtacacgacgcgcaagccgcgc
cccggcgaacaggacggccagcactatcacttcacgaccgtcgaggatttccgcgagcgc
catgcgcgccacgagtttctcgaaagcgccgaggtgcacggcaattactacggcacgtcg
cgcgtgtggatcgaagagcagatgaagatcggccacgacgtgctgctcgaaatcgattgg
cagggcgcgcagcaggtgaagaagcagttccgcaacgcggtcggcatcttcatcctgccg
ccgtcgctcgcggcgctcgaagagcggctcaagaagcgcgggcaggacgagccgaacgtg
atcacgcggcgcctgctcgccgcgggcagcgagatcgcgcacgcggcggaagcgcagtac
gtcgtcatcaacgagaccttcgagcacgcgctcgccgagctcgagtgcatcgtcgcggcg
acgcgcctgcgcttcacgtcgcaatatgcgcggcatgccgaactattcgtcgagctcggc
attcatctgccgcacgcggagtga

DBGET integrated database retrieval system