KEGG   Burkholderia pseudomallei BPC006: BPC006_I3096Help
Entry
BPC006_I3096      CDS       T02301                                 

Definition
(GenBank) glucokinase
  KO
K00845  glucokinase [EC:2.7.1.2]
Organism
bpq  Burkholderia pseudomallei BPC006
Pathway
bpq00010  Glycolysis / Gluconeogenesis
bpq00052  Galactose metabolism
bpq00500  Starch and sucrose metabolism
bpq00520  Amino sugar and nucleotide sugar metabolism
bpq00521  Streptomycin biosynthesis
bpq01100  Metabolic pathways
bpq01110  Biosynthesis of secondary metabolites
bpq01120  Microbial metabolism in diverse environments
bpq01130  Biosynthesis of antibiotics
bpq01200  Carbon metabolism
Module
bpq_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Brite
KEGG Orthology (KO) [BR:bpq00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    BPC006_I3096
   00052 Galactose metabolism
    BPC006_I3096
   00500 Starch and sucrose metabolism
    BPC006_I3096
   00520 Amino sugar and nucleotide sugar metabolism
    BPC006_I3096
  Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    BPC006_I3096
   00524 Neomycin, kanamycin and gentamicin biosynthesis
    BPC006_I3096
Enzymes [BR:bpq01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.2  glucokinase
     BPC006_I3096
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Glucokinase HTH_6 SIS SIS_2 ROK LacI HTH_IclR
Motif
Other DBs
NCBI-ProteinID: AFR16943
Position
I:3013481..3015343
Genome map
AA seq 620 aa AA seqDB search
MADVGGTNARFALETGPGEITQIRVYPGAEYPTLTDAIRKYLKDAKIGRVNHAAIAIANP
VDGDQVRMTNHNWSFSIEATRRALGFDTLLVVNDFTALAMALPGLTDAQRVQIGGGTRRQ
NSVIGLMGPGTGLGVSGLIPADDRWIALGSEGGHATFAPMDEREDLVLQYARRKYPHVSF
ERVCAGPGMEIIYRALAARDKKRIAANVDTADIVERAHAGDALALEAVECFCAILGTFAG
NLAVTLGALGGIYIGGGVVPKLGELFMRSPFRARFEAKGRFEAYLANIPTYLITAEYPAF
LGVSAILAEQLSNRTGGASSAVFERIRQMRDALTPAERRVADLALNHPRSIINDPIVDIA
RKADVSQPTVIRFCRSLGCQGLSDFKLKLATGLTGTIPMSHSQVHLGDTATDFGAKVLDN
TVSAILQLREHLNFEHVEQAIDILNNARRIEFYGLGNSNIVAQDAHYKFFRFGIPTIAYG
DLYMQAASAALLGKGDVIVAVSKSGRAPELLRVLDVAMQAGAKVIAITSSNTPLAKRATV
ALETDHIEMRESQLSMISRILHLVMIDILAVGVAIRRAAPNAELAEAMARAKARAGASAG
DEAADVLDWLSHGAAPAAKD
NT seq 1863 nt NT seq  +upstreamnt  +downstreamnt
ttggccgacgtcggcggcacgaacgcgcgcttcgcgctcgagacgggcccgggagaaatc
acgcagatccgcgtgtacccgggcgccgagtatccgacgctcaccgacgcgatccgcaag
tacctgaaggacgcgaagatcggccgcgtgaatcacgcggcgatcgcgatcgcgaacccc
gtcgacggcgatcaggtccggatgacgaatcacaactggagcttctcgatcgaggcgacg
cgccgcgcgctcggcttcgatacgctgctcgtcgtcaacgatttcaccgcgctcgcgatg
gcgctgcccggcctgaccgatgcgcagcgcgtacagatcggcggcggcacgcgccggcag
aacagcgtgatcggcctgatggggccgggcacggggctcggcgtgtcggggctcattccc
gccgacgaccgctggatcgcgctcggcagcgaaggcggccacgcgacgttcgcgccgatg
gacgagcgcgaggatctcgtgctgcaatacgcgcgccgcaagtatcctcacgtgtcgttc
gagcgcgtgtgcgcgggcccgggcatggagatcatctatcgcgcgctcgccgcgcgcgac
aagaagcgcatcgccgcgaacgtcgacacggccgacatcgtcgagcgcgcgcacgcgggc
gatgcgctcgcgctcgaggcggtcgagtgcttctgcgcgattctcggcacgttcgccggc
aacctcgcggtcacgctcggcgcgttgggcggcatctatatcggcggcggcgtcgtgccg
aagctcggcgagctgttcatgcgctcgccgtttcgcgcgcgcttcgaggcgaagggccgc
ttcgaggcgtatctcgcgaacatcccgacctacctgatcaccgcggaatacccggcgttt
ctcggcgtatcggcgatcctcgccgagcaactgtcgaaccgcacgggcggcgcgtcgtcg
gccgtgttcgagcgcatccgccagatgcgcgacgcgttgacgcccgccgagcggcgcgtc
gccgatctcgcgctcaaccatccgcgctcgatcatcaacgatccgatcgtcgacatcgcg
cgcaaggccgacgtgagccagcccaccgtgatccgcttctgccgctcgctcggctgccag
gggctgtcggacttcaagctgaagctcgcgacgggcctcaccggcacgatcccgatgagc
cacagccaggtgcatctgggcgacaccgcgaccgatttcggcgcgaaggtgctcgacaac
acggtatcggcgatccttcagttgcgcgagcatctgaacttcgagcacgtcgagcaggcg
atcgacatcctgaacaacgcgcggcgcatcgagttctacggcctgggcaattcgaacatc
gtcgcgcaggacgcgcactacaagttcttccgcttcgggattccgacgatcgcgtacggc
gacctgtacatgcaggcggcgtcggccgcgctcctcggcaagggcgacgtgatcgtcgcg
gtgtcgaagtcggggcgcgcgccggagctgttgcgcgtgctcgacgtcgcgatgcaggcg
ggcgcgaaggtgatcgcgatcacgtcgagcaacacgccgctcgccaagcgcgcgacggtc
gcgctcgagaccgatcacatcgagatgcgcgagtcgcagttgtcgatgatctcgcggatc
ctgcatctcgtgatgatcgacatcctcgcggtcggcgtcgcgatccgccgcgccgcgccg
aacgcggagctcgcggaggcgatggcgcgcgcgaaggcgcgcgcgggcgcgagcgcgggc
gacgaggccgccgacgtgctcgactggctgagccacggcgcggcgcccgcggcgaaggac
tga

DBGET integrated database retrieval system