KEGG   Burkholderia pseudomallei BPC006: BPC006_I3189Help
Entry
BPC006_I3189      CDS       T02301                                 

Definition
aspartate carbamoyltransferase catalytic subunit
Orthology
K00609  
aspartate carbamoyltransferase catalytic subunit [EC:2.1.3.2]
Organism
bpq  Burkholderia pseudomallei BPC006
Pathway
Pyrimidine metabolism
Alanine, aspartate and glutamate metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:bpq00001]
 Metabolism
  Nucleotide metabolism
   00240 Pyrimidine metabolism
    BPC006_I3189
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    BPC006_I3189
Enzymes [BR:bpq01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.3  Carboxy- and carbamoyltransferases
    2.1.3.2  aspartate carbamoyltransferase
     BPC006_I3189
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
I:complement(3096561..3097646)
Genome map
AA seq 361 aa AA seqDB search
MRVAHPGAVWQHVGITHIMTTDTSGRTGNPAAAAPAERFRYGFLKGNPQLTKNGELKHLL
TIEGLPRAILNQILDTAEQFVSVTDREVKKVPLLRGKSVFNLFFENSTRTRTTFEIAAKR
LSADVINLNINASSTSKGESLLDTINNLSAMHADLFVVRHASSGAPYLIAEHCAPHVHVI
NAGDGRHAHPTQGLLDMYTIRHYKRDFTKLRVAIVGDILHSRVARSDIHALTTLGVPEVR
AIGPRTLLPGGLEQMGVRVFHNLDEGLRDVDVIIMLRLQNERMSGALLPSAQEYFKSWGL
TPERLALAAPDAIVMHPGPMNRGVEIDSQVADGPQSVILNQVTFGIAVRMAVMGIVAGTS
D
NT seq 1086 nt NT seq  +upstreamnt  +downstreamnt
gtgcgcgtcgcgcatccgggcgccgtttggcaacacgttggaatcacgcacatcatgacg
accgacacctccggccgcaccggcaatcccgccgcggccgcgcccgccgagcgctttcgc
tatggctttctgaagggcaacccgcagctcacgaagaacggcgagctcaagcatctgttg
acgatcgagggcctgccgcgcgcgatcctcaatcagattctcgacaccgccgagcagttc
gtcagcgtgaccgaccgcgaagtgaagaaggtgccgctcttgcgcggcaaatcggtattc
aacctgttcttcgagaattcgacgcgcacgcgcacgacgttcgagatcgccgcgaagcgg
ctgtccgccgacgtgatcaacctgaacatcaacgcgtcgtcgacgagcaagggcgagtcg
ctcctcgacacgatcaacaatctgtcggcgatgcacgccgatctcttcgtcgtgcgccac
gcatcgagcggcgcgccgtacctgatcgccgagcactgcgcgccgcacgtgcacgtgatc
aacgcgggcgacggccgtcacgcgcacccgacgcagggccttctcgacatgtacacgatc
cgccactacaagcgcgacttcacgaagctgcgcgtcgcgatcgtcggcgacattctccat
tcgcgcgtcgcgcgctcggacattcacgcgctgacgacgctcggcgtgcccgaggtgcgc
gcgatcggcccgcgcacgctgctgccgggcgggctcgagcagatgggcgtgcgcgtgttc
cacaatctcgacgaaggcctgagggacgtcgacgtgatcatcatgctgcgcctgcagaac
gagcggatgagcggcgcgctgctgccgtccgcgcaggaatatttcaagagctggggcttg
acgcccgagcgccttgcgctcgccgcgcccgacgcgatcgtgatgcacccggggccgatg
aaccgcggcgtcgagatcgattcgcaagtggccgacggcccgcaatcggtgatcctgaac
caggtgacgttcggcatcgcggtgcgcatggccgtgatgggcatcgtcgcgggcacgagc
gactga

DBGET integrated database retrieval system