KEGG   Burkholderia pseudomallei BPC006: BPC006_I3293Help
Entry
BPC006_I3293      CDS       T02301                                 

Definition
UTP-glucose-1-phosphate uridylyltransferase
Orthology
K00963  
UTP--glucose-1-phosphate uridylyltransferase [EC:2.7.7.9]
Organism
bpq  Burkholderia pseudomallei BPC006
Pathway
Pentose and glucuronate interconversions
Galactose metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:bpq00001]
 Metabolism
  Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    BPC006_I3293
   00052 Galactose metabolism
    BPC006_I3293
   00500 Starch and sucrose metabolism
    BPC006_I3293
   00520 Amino sugar and nucleotide sugar metabolism
    BPC006_I3293
Enzymes [BR:bpq01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.9  UTP---glucose-1-phosphate uridylyltransferase
     BPC006_I3293
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
I:3184986..3185960
Genome map
AA seq 324 aa AA seqDB search
MCVAGIASPRSRAAGPHANVQRLRWKVRRPMLKVTKAVFPVAGLGTRFLPATKASPKEML
PIVDKPLIQYAVEEAIAAGITEMIFVTGRSKRAIEDHFDKSYEIEAELEARGKEKLLTLV
RGIKPRHVDCFYVRQAEALGLGHAVLCAQKLVGDSPFAVVLADDLLDGRPPVLRQMIDVF
NHYHTSVIGVEQIAPQDSKSYGVIDGKRWEDNLFKLSGIVEKPEPAAAPSNFGVVGRYVL
TPRIFDHLRALKPGAGGELQLTDALQSLLKDEQVLAHRYDGLRFDCGSKIGYLKATVEFA
LRHPEVAPEFERYLSERFPELVAA
NT seq 975 nt NT seq  +upstreamnt  +downstreamnt
gtgtgcgtcgccggtatcgcctcccctcgatcacgcgccgccggcccgcacgcaaacgtt
caacgtcttcgatggaaggttcgacgcccgatgctgaaagtcacaaaagccgtattcccc
gtcgccggcctcggcacccgctttttgcccgcgacgaaagcgagtccgaaggaaatgctg
ccgatcgtcgacaagcccctgattcagtatgcggtcgaggaagcgatcgccgcgggcatc
accgagatgatcttcgtcacgggccgcagcaagcgcgccatcgaggaccatttcgacaaa
tcgtatgagatcgaggcggagctcgaagcccgcggcaaggaaaagctgctgacgctcgtg
cgcggcatcaagccgcggcatgtcgattgtttctacgtgcgccaggccgaagcgctcggg
ctcggtcacgcggtgctgtgcgcgcagaagctcgtcggcgacagcccgttcgccgtcgtc
ctcgcggacgacctgctcgacgggcggccgcccgtgctgcggcagatgatcgacgtgttc
aatcactatcacacgtccgtcatcggcgtcgagcagatcgccccgcaggattcgaagtcg
tacggcgtgatcgacggcaagcgctgggaagacaatctcttcaagctgtcgggcatcgtc
gagaagcccgagccggccgccgcgccgtcgaatttcggcgtcgtcggccgctacgtgctc
acgccgcgcatcttcgaccatctgcgcgcgctcaagcccggggcgggcggcgaactgcaa
ttgaccgacgcgctgcaatcgctgttgaaggacgagcaagtgctcgcgcatcgctacgac
ggcctgcgcttcgattgcggcagcaagatcggctatttgaaggcgacggtcgagttcgcg
ctgcgccacccggaagtcgcccccgaattcgaacggtatctgagcgagcgctttccggag
ctcgtggccgcatga

DBGET integrated database retrieval system