KEGG   Burkholderia pseudomallei BPC006: BPC006_I3443Help
Entry
BPC006_I3443      CDS       T02301                                 

Definition
glutathione S-transferase family protein
Orthology
K00799  
glutathione S-transferase [EC:2.5.1.18]
Organism
bpq  Burkholderia pseudomallei BPC006
Pathway
Glutathione metabolism
Class
Metabolism; Metabolism of other amino acids; Glutathione metabolism [PATH:bpq00480]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
I:complement(3338711..3339322)
Genome map
AA seq 203 aa AA seqDB search
MMKLIGSLSSPFVRKARIVLAEKKIDYKLELENVWAPDTNIHASNPIGKVPCLVMEDGAA
VFDSRVICEYVDTLSPVGKLIPPSGRERVEVRCWEALGDGVLDAAVAIRIEHTQREPQHR
SDAWIARQQRKVDDGLVAMSQGLAGKTWCVGNHYTLADIALGCTLGYLDFRMPEINWRER
HPNLDKHFAKLAQRQPFVDTVPQ
NT seq 612 nt NT seq  +upstreamnt  +downstreamnt
atgatgaaattaatcggttcgctcagcagcccgttcgtccgcaaggcgcggatcgtgctc
gctgaaaagaagatcgactacaagctggagctcgaaaacgtctgggcgccggacacgaac
atccatgcgtcgaatccgatcggcaaggtgccgtgcctcgtgatggaggacggcgcggcc
gtgttcgactcgcgcgtgatctgcgaatacgtcgacacgctttcgcccgtcggcaagctg
attccgccgtcggggcgcgagcgcgtcgaggtgcggtgctgggaggcgctcggcgacggc
gtgctcgacgcggcggtcgcgattcgcatcgagcacacgcagcgcgagccgcagcatcgc
agcgatgcgtggatcgcgcgccagcagcgcaaggtcgacgacggcctcgtcgcgatgtcg
cagggcctcgccggcaagacgtggtgcgtcggcaaccactacacgctcgccgacatcgcg
ctcgggtgcacgctcggctacctcgatttccggatgcccgagatcaactggcgcgaacgc
catccgaatctcgacaagcatttcgcgaagctggcgcagcgccagccgttcgtcgacacg
gtgccccagtaa

DBGET integrated database retrieval system