KEGG   Burkholderia pseudomallei BPC006: BPC006_I3451Help
Entry
BPC006_I3451      CDS       T02301                                 

Definition
Holliday junction DNA helicase RuvA
Orthology
K03550  
holliday junction DNA helicase RuvA [EC:3.6.4.12]
Organism
bpq  Burkholderia pseudomallei BPC006
Pathway
Homologous recombination
Brite
KEGG Orthology (KO) [BR:bpq00001]
 Genetic Information Processing
  Replication and repair
   03440 Homologous recombination
    BPC006_I3451
Enzymes [BR:bpq01000]
 3. Hydrolases
  3.6  Acting on acid anhydrides
   3.6.4  Acting on acid anhydrides to facilitate cellular and subcellular movement
    3.6.4.12  DNA helicase
     BPC006_I3451
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
I:3346624..3347205
Genome map
AA seq 193 aa AA seqDB search
MIGRIAGTLLEKNPPHILVDCNGVGYEVDVPMSTFYNLPHTGEKVVLLTQLIVREDAHLL
YGFLTPPERSTFRELLKITGVGARMALAVLSGMSVAELSQAVTLQDAARLTRVPGIGKKT
AERLLLELKGKLGADLGPLAGAASPSDHATDILNALVALGYSEKEALAAIKNVPAGTGVS
EGIKLSLKALSKA
NT seq 582 nt NT seq  +upstreamnt  +downstreamnt
atgatcggtcgcatcgccggcaccctcctcgaaaaaaatccgccgcacatcctcgtcgac
tgcaacggcgtcggctacgaagtcgacgtgccgatgagcacgttctacaacctgccgcac
acgggcgagaaggtcgtgctgctgacccagttgatcgtccgcgaggacgcgcacctgctg
tacggctttctcacgccgccggagcgctcgacgttccgcgagttgctcaagatcacgggc
gtcggcgcgcggatggcgcttgccgtgctgtccggcatgagcgtcgcggaactgtcgcaa
gcggtcacgctgcaggacgccgcgcgcctcacccgcgtgcccggcatcggcaagaaaacg
gccgagcgcctgctcctcgagctgaaaggcaagctcggcgccgatctcggcccgctcgcc
ggcgcggcatcgccctccgaccatgcgaccgacatcctcaacgcgctcgtcgcgctcggc
tactcggaaaaggaggcgcttgccgcgatcaagaacgtgccggccggcaccggcgtgtcc
gaaggcatcaagctgtcgctcaaggcgctgtcgaaggcgtaa

DBGET integrated database retrieval system