KEGG   Burkholderia pseudomallei BPC006: BPC006_I3573Help
Entry
BPC006_I3573      CDS       T02301                                 

Definition
gamma-glutamyl kinase
Orthology
K00931  
glutamate 5-kinase [EC:2.7.2.11]
Organism
bpq  Burkholderia pseudomallei BPC006
Pathway
Arginine and proline metabolism
Metabolic pathways
Biosynthesis of amino acids
Module
Proline biosynthesis, glutamate => proline
Class
Metabolism; Overview; Biosynthesis of amino acids [PATH:bpq01230]
Metabolism; Amino acid metabolism; Arginine and proline metabolism [PATH:bpq00330]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
I:complement(3456013..3457197)
Genome map
AA seq 394 aa AA seqDB search
MKPGGAAGVRDSIAHHSRRQRTMRSIIADSKRLVVKVGSSLVTNDGRGLDHDAIGRWAAQ
IAALRGAGKEVVLVSSGAIAEGMQRLGWSKRPREIDELQAAAAVGQMGLAQVYESRFAEH
GIRTAQILLTHADLADRERYLNARSTLLTLLRLGVVPIINENDTVVTDEIKFGDNDTLGA
LVANLIEGDTLVILTDQPGLFTADPRKDPGATLVAEASAGAPELEAMAGGAGSSIGRGGM
LTKILAAKRAAHSGANTVIASGRERDVLVRLAAGEAIGTQLIARTARMAARKQWMADHLQ
VRGHVVIDAGAVDKLTAGGKSLLPIGVVAVQGVFARGEVIACVDDTGREVARGITNYSSA
ETKLIQRKPSGEIETVLGYMLEPELIHRDNLVLV
NT seq 1185 nt NT seq  +upstreamnt  +downstreamnt
atgaagccgggcggcgcggccggcgtacgggattcaatcgcgcatcactcaaggagacag
cgcacgatgcgttcgatcatcgccgattcgaagcgcctggtagtgaaagtgggctcgagc
ctcgtcaccaacgacggccgcgggctcgatcatgacgccatcggccgatgggccgcccag
atcgccgcgctgcgcggcgcgggcaaggaagtggtgctcgtcagctcgggcgcgatcgcg
gaaggcatgcagcgcctcggttggagcaagcggccgcgcgagatcgacgagttgcaagcg
gccgcggccgtcgggcaaatggggctcgcgcaggtatacgagagccggtttgccgaacac
gggatccgcaccgcgcagattctcctcacgcatgcggatctcgccgaccgcgaacgctac
ctgaacgcgcgctcgacgctcctcacgctgctgcggctcggcgtcgtgccgatcatcaac
gagaacgacaccgtcgtcaccgacgaaatcaagttcggcgacaacgacacgctcggcgcg
ctcgtcgcgaatctgatcgaaggcgatacgctcgtcatcctgaccgaccagccggggctg
ttcacggccgatccgcgcaaggatccgggcgcgacgctcgttgccgaggcgagcgccggt
gcgccggagctcgaagcgatggcgggcggcgcgggctcgagcatcggccgcggcggcatg
ctgacgaagattctcgcggccaagcgcgccgcgcacagcggcgcgaacaccgtgatcgcg
agcggccgcgagcgcgacgtgctcgtgcggctcgcggccggcgaggcgatcggcacgcaa
ctgatcgcgcgcaccgcgcggatggcggcgcgcaagcaatggatggcggaccacctgcag
gtacgtggccatgtcgttatcgatgcgggggcggtcgacaagttgacggcggggggcaag
agcctgttgccgatcggcgtcgtcgccgtgcagggcgtgttcgcgcgcggcgaagtgatc
gcgtgcgtcgacgacaccggccgtgaagtcgcgcgcgggatcaccaattacagcagcgcc
gaaacgaagctgatccagcgcaagccgagcggcgagatcgaaacggtgctcggctacatg
ctcgagcccgagctgatccatcgggacaatctcgtgctggtctga

DBGET integrated database retrieval system