KEGG   Burkholderia pseudomallei BPC006: BPC006_I3639Help
Entry
BPC006_I3639      CDS       T02301                                 

Definition
Indole-3-glycerol phosphate synthase
Orthology
K01609  
indole-3-glycerol phosphate synthase [EC:4.1.1.48]
Organism
bpq  Burkholderia pseudomallei BPC006
Pathway
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of amino acids
Module
Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:bpq00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    BPC006_I3639
  Amino acid metabolism
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    BPC006_I3639
Enzymes [BR:bpq01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.48  indole-3-glycerol-phosphate synthase
     BPC006_I3639
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
I:3522023..3522808
Genome map
AA seq 261 aa AA seqDB search
MSDILDKIIAVKREEIAAALESAPLEELKVQASARDSRDFVGALRDKHAAGHAAVIAEVK
KASPSKGVLREHFVPADIARSYAQHGAACLSVLTDERFFQGSARYLEQARAACALPVLRK
DFIVDAYQVLEARAMGADAILLIAAALDTPLMIDLEAYAHSLGLAVLVEVHNRGELDEAL
KLKTPLVGINNRNLRTFETTIDTTLGMLDAIPDDRIVVTESGILSRADVERMEAAGVHTF
LVGEAFMRAENPGAELARMFF
NT seq 786 nt NT seq  +upstreamnt  +downstreamnt
atgagcgacatcctcgacaaaatcatcgccgtcaagcgcgaagagatcgccgccgcgctc
gagagcgcgccgctcgaagaactgaaggtgcaggcgtcggcgcgcgattcgcgcgacttc
gtcggcgcgctgcgcgacaagcacgcggccggacacgccgccgtcatcgccgaggtgaag
aaggcgagcccgtcgaaaggcgtgctgcgcgagcatttcgtgccggccgacatcgcccgc
tcgtacgcgcagcacggcgccgcatgcctgtcggtgctgaccgacgagcggttcttccag
ggcagcgcgcgctatctcgaacaggcgcgcgccgcgtgcgccctgcccgtgctgcgcaag
gacttcatcgtcgacgcgtaccaggtgctcgaagcgcgcgcgatgggcgcggacgcgatc
ctgctgatcgccgcggcgctcgacacgccgctgatgatcgatctcgaggcgtacgcgcat
tcgctcgggctcgcggtgctcgtcgaagtgcacaaccgcggcgaactggacgaagcgttg
aaactgaagacgccgctcgtcggcatcaacaaccgcaacctgcgtacattcgagacgacg
atcgacacgacgctcggcatgctcgacgcgattccggacgatcggatcgtcgtcaccgaa
tccggcatcctgtcgcgcgcggacgtcgagcggatggaggcggcgggcgtgcatacgttc
ctcgtcggcgaagcgttcatgcgcgccgagaacccgggcgcggaactcgcgcggatgttc
ttctga

  All links  
No link information was found.   
DBGET integrated database retrieval system