KEGG   Burkholderia pseudomallei BPC006: BPC006_I3777Help
Entry
BPC006_I3777      CDS       T02301                                 

Definition
histidinol dehydrogenase
Orthology
K00013  
histidinol dehydrogenase [EC:1.1.1.23]
Organism
bpq  Burkholderia pseudomallei BPC006
Pathway
Histidine metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:bpq00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    BPC006_I3777
  Amino acid metabolism
   00340 Histidine metabolism
    BPC006_I3777
Enzymes [BR:bpq01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.23  histidinol dehydrogenase
     BPC006_I3777
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
I:complement(3664386..3665723)
Genome map
AA seq 445 aa AA seqDB search
MAIKIRKLDSTSEGFAAELRAVLAFEASEDDAIERAVAQILADVKARGDAAVLDYTNRFD
RLNAASVAALELPQSELEAALEGLEPKRRAALEAAAARVRGYHEKQKIECGSHSWQYTEA
DGTVLGQKVTPLDRVGLYVPGGKAAYPSSVLMNAIPARVAGVGEIVMVVPTPDGLKNDLV
LAAALLGGVDRVFTIGGAQAVAALAYGTQTVPAVDKICGPGNAYVASAKRRVFGTVGIDM
IAGPSEILVLCDGTTDPSWVAMDLFSQAEHDELAQSILLCPDEAFIERVEKAIGELLPTM
PRQDVIRASLEGRGALVKVRDMAEACRIANDIAPEHLEISALEPHQWGKQIRHAGAIFLG
RYTSESLGDYCAGPNHVLPTSRTARFSSPLGVYDFFKRSSLIEVSAEGAHTLGEIASELA
YGEGLQAHAKSAEYRMKGAGDRQKG
NT seq 1338 nt NT seq  +upstreamnt  +downstreamnt
atggctatcaagatacgcaaactcgattcgacaagcgaaggcttcgcggccgaattgcgc
gcggtgctcgcgttcgaggcgagcgaagacgacgcgatcgagcgcgcggtcgcgcagatt
ctcgccgacgtgaaggcgcgcggcgacgccgcggtgctcgactacacgaatcgcttcgac
cggctgaacgcggcgagcgtcgcggcgctcgagctgccgcaaagcgagctggaagcggcg
ctcgagggcctcgagccgaagcgccgcgcggcgctcgaagcggcggccgcgcgcgtgcgc
ggctaccacgagaagcagaagatcgaatgcggcagccatagctggcagtacaccgaggcc
gacggcaccgtgctcggccagaaggtgacgccgctcgaccgcgtcggcctgtacgtgccg
ggcggcaaggccgcgtatccgtcgtcggtgctgatgaacgcgattccggcgcgcgtcgcg
ggcgtcggcgagatcgtgatggtcgtgccgacgccggacggcctgaagaacgatctcgtg
ctcgccgcggcgctgttgggcggcgtcgatcgcgtgttcacgatcggcggcgcgcaggcg
gtggccgcgctcgcgtacggcacgcaaacggtgcccgccgtcgacaagatctgcgggccg
ggcaacgcgtacgtcgcgtcggccaagcgccgcgtgttcggcacggtcggcatcgacatg
atcgccgggccgtcggagatcctcgtgctgtgcgacggcacgaccgatccgtcgtgggtc
gcgatggacctgttctcgcaggccgagcacgacgagctcgcgcaatcgatcctgctgtgc
ccggacgaagcgttcatcgagcgcgtcgagaaggcgatcggcgagctgctgccgacgatg
ccgcgccaggacgtgatccgcgcgtcgctcgaggggcgcggcgcgctcgtcaaggtgcgc
gacatggccgaggcgtgcaggatcgcgaacgacatcgcgcccgagcacctggaaatctcc
gcgctcgagccgcaccaatggggcaagcagatccgccacgcgggcgcgatcttcctcggc
cgctacacgagcgagagcctgggcgattactgcgcgggcccgaatcacgtgctgccgacg
tcgcgcaccgcgcgcttttcgtcgccgctcggcgtgtacgatttcttcaagcgctcgagc
ctgatcgaggtgagcgccgaaggcgcgcacacgctcggcgagatcgcgtccgagctcgcg
tacggcgaaggtttgcaggcgcacgcgaagagcgccgagtaccggatgaaaggagcgggc
gaccgccagaaaggctaa

  All links  
No link information was found.   
DBGET integrated database retrieval system