KEGG   Burkholderia pseudomallei BPC006: BPC006_I3972Help
Entry
BPC006_I3972      CDS       T02301                                 

Definition
chemotaxis-specific methylesterase
Orthology
K03412  
two-component system, chemotaxis family, response regulator CheB [EC:3.1.1.61]
Organism
bpq  Burkholderia pseudomallei BPC006
Pathway
Two-component system
Bacterial chemotaxis
Brite
KEGG Orthology (KO) [BR:bpq00001]
 Environmental Information Processing
  Signal transduction
   02020 Two-component system
    BPC006_I3972
 Cellular Processes
  Cell motility
   02030 Bacterial chemotaxis
    BPC006_I3972
Enzymes [BR:bpq01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.61  protein-glutamate methylesterase
     BPC006_I3972
Two-component system [BR:bpq02022]
 CheA family
  CheA-CheYBV
   BPC006_I3972
Bacterial motility proteins [BR:bpq02035]
 Flagellar system
  Chemotaxis proteins
   Two component system proteins
    BPC006_I3972
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
I:complement(3851243..3852337)
Genome map
AA seq 364 aa AA seqDB search
MQKKIKVLCVDDSALIRSLMTEIINSQPDMEVCATAPDPLVARELIKQHNPDVLTLDVEM
PRMDGLDFLEKLMRLRPMPVVMVSSLTERGSEITLRALELGAVDFVTKPRVGIRDGMLDY
SEKLADKVRAASRARVRQNPQPHAAAAAAAHGHAGAAAPLINNPLVSTEKLIIVGASTGG
TEAIREVLTPLPPDAPAVLIAQHMPPGFTRSFAQRLNGLCRISVKEAEHGERVLPGHAYI
APGHAHLLLARSGANYIAHLSDEPPVNRHRPSVDVLFRSAAQHAGKNALGVILTGMGRDG
AAGLLEMKKAGAYTFAQDEASCVVFGMPREAIAMGGVDDVAPLSDMSRRIMARLASMGDR
VQRV
NT seq 1095 nt NT seq  +upstreamnt  +downstreamnt
gtgcagaagaaaatcaaagtgctgtgcgtcgacgattcggcgctgatccgcagcctgatg
acagaaatcatcaacagccagcccgacatggaagtgtgcgcaacggcgcccgatccgctc
gtggcgcgcgagctgatcaagcagcacaacccggacgtgctgacgctcgacgtcgaaatg
ccgcggatggacgggctcgacttccttgaaaagctgatgcgcctgcggccgatgccggtc
gtgatggtgtcgtcgctcaccgagcgcggctcggagatcacgctgcgcgcgctcgagctg
ggcgcggtcgatttcgtgacgaagccgcgcgtcgggattcgcgacggcatgctcgactat
tcggaaaagctggccgacaaggtgcgcgcggcatcgcgcgcgcgcgtgcggcagaatccg
cagccgcatgcggctgccgccgcggccgcgcacggccacgcgggcgccgccgcgccgctc
atcaacaatccgcttgtcagtaccgagaagctgatcatcgtcggcgcgtccacgggcggc
accgaggcgatccgcgaagtgctgacgccgctgccgcccgatgcgcccgccgtgctgatc
gcgcagcacatgccgcccggcttcacgcgctcgttcgcgcagcgcctgaacgggctgtgc
cggatctcggtgaaggaggcggagcacggcgagcgcgtgctgccggggcacgcgtatatc
gcgcccggccacgcgcacctgctgctcgcgaggagcggcgcgaactacatcgcgcacctg
tcggacgagccgcccgtcaatcgtcatcgcccgtcggtcgacgtgctgttccgctcggcc
gcgcagcatgcgggcaagaacgcgctcggcgtgatcctgacgggcatgggccgcgacggc
gcggccgggctgcttgaaatgaaaaaggccggcgcgtatacatttgcgcaggacgaggcg
agctgcgtcgtgttcggaatgccgcgcgaggcgatcgcgatgggcggcgtcgacgacgtc
gcgcccctttccgacatgagtcgccgtatcatggcgcgcctcgcgtcgatgggcgatcgc
gtgcagcgcgtgtga

  All links  
No link information was found.   
DBGET integrated database retrieval system