KEGG   Burkholderia pseudomallei BPC006: BPC006_II0504Help
Entry
BPC006_II0504     CDS       T02301                                 

Definition
(GenBank) acetyl-CoA synthetase
  KO
K01895  acetyl-CoA synthetase [EC:6.2.1.1]
Organism
bpq  Burkholderia pseudomallei BPC006
Pathway
bpq00010  Glycolysis / Gluconeogenesis
bpq00620  Pyruvate metabolism
bpq00640  Propanoate metabolism
bpq00680  Methane metabolism
bpq01100  Metabolic pathways
bpq01110  Biosynthesis of secondary metabolites
bpq01120  Microbial metabolism in diverse environments
bpq01130  Biosynthesis of antibiotics
bpq01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:bpq00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    BPC006_II0504
   00620 Pyruvate metabolism
    BPC006_II0504
   00640 Propanoate metabolism
    BPC006_II0504
  Energy metabolism
   00680 Methane metabolism
    BPC006_II0504
Enzymes [BR:bpq01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.1  acetate---CoA ligase
     BPC006_II0504
Lipid biosynthesis proteins [BR:bpq01004]
 Acyl-CoA synthetase
  Short/medium chain acyl-CoA synthetase
   BPC006_II0504
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AMP-binding AMP-binding_C ACAS_N
Motif
Other DBs
NCBI-ProteinID: AFR18437
Position
II:513000..514982
Genome map
AA seq 660 aa AA seqDB search
MSAIESVLHERRQFAPPAAVEKAAAISGMAAYRALAEEAERDYEGFWARLARETLEWRKP
FGKVLDETNAPFYKWFEDGELNASYNCLDRHVAAGLGERVAVIFEADDGTVTRVTYADLL
ARVSRFANALKKRGVGRGDRVVIYIPMSVEGIVAMQACARIGATHSVVFGGFSSKSLHER
IVDVGATALVTADEQMRGGKTLPLKSIADEALAMGGCDAVKTVVVYRRTGGNVDWHAGRD
VWMHEMVANESDACEPEWVGAEHPLFILYTSGSTGKPKGVQHSTAGYLLWVAQTMKWTFD
WKPDDVFWCTADIGWVTGHSYITYGPLAVGATQVVFEGVPTYPNAGRFWKMIGDHKVTVF
YTAPTAIRSLIKAAEADDRVHPRSYDLSSLRIIGTVGEPINPEAWIWYHKNVGQARCPIV
DTWWQTETGGHMITPLPGATPTVPGSCTLPLPGIMAAVVDETGQDVPNGQGGILVVKRPW
PAMARTIWGDPERFKKSYFPEELGGRLYLAGDGTVRDKETGYFTIMGRIDDVLNVSGHRL
GTMEIESALVSHELVAEAAVVGRPDDTTGEAVVAFVVLKRSRPEGEEAAALAKTLRDWVG
KEIGPIAKPKDIRFGDNLPKTRSGKIMRRLLRSLAKGEAITQDTSTLENPAILEQLAEVR
NT seq 1983 nt NT seq  +upstreamnt  +downstreamnt
atgtctgcgattgaatcggttctgcacgaacgccgccagttcgcgccgcccgccgccgtg
gagaaggcggcagccatttccgggatggcggcttatcgggcgctcgccgaagaggctgag
cgcgattacgaaggattctgggcgcgtctcgcgcgcgagacgctcgaatggcgcaagccg
ttcggcaaggtgctcgacgagacgaacgcgccgttctacaagtggttcgaggacggcgag
ctgaacgcgtcgtacaactgcctcgaccgccacgtcgccgcgggcttgggcgagcgcgtc
gcggtgatcttcgaggccgacgacggcaccgtcacgcgcgtcacctacgccgatctgctc
gcgcgcgtgtcgcgcttcgcgaacgcgctgaagaagcgcggcgtcggccgcggcgaccgc
gtcgtcatctacattccgatgtcggtcgaaggcatcgtcgcgatgcaggcatgcgcgcgg
atcggcgcgacgcactcggtggtgttcggcggcttctcgtcgaagtcgctgcacgagcgc
atcgtcgacgtcggcgcgaccgcgctcgtcaccgccgacgagcagatgcgcggcggcaag
acgctgccgctcaagagcatcgccgacgaggcgctcgcgatgggcggctgcgacgcggtg
aagaccgtcgtcgtgtatcgccgcacgggcggcaatgtcgactggcacgcgggccgcgac
gtctggatgcacgagatggtcgcgaacgagtccgacgcgtgcgagcccgaatgggtcggc
gccgagcatccgctgttcatcctgtacacgtccggctcgaccggcaagccgaagggcgtc
cagcacagcacggccggctatctgctgtgggtcgcgcagacgatgaagtggacgttcgac
tggaagcccgacgacgtgttctggtgcacggccgacatcggctgggtcacgggccactcg
tatatcacgtacgggccgctcgccgtcggcgcgacgcaggtggtgttcgagggcgtgccg
acctatccgaacgcgggccgcttctggaagatgatcggcgaccacaaggtcaccgtgttc
tacaccgcgccgaccgcgatccgctcgctgatcaaggcggccgaggccgacgaccgcgtg
catccgaggagctacgatctgtcgagcctgcggatcatcggcacggtcggcgagccgatc
aatccggaagcgtggatctggtatcacaagaacgtcgggcaggcgcgctgcccgatcgtc
gacacctggtggcagaccgaaacgggcggccacatgatcacgccgctaccgggcgcgacg
ccgacggtgccgggctcgtgcacgctgccgctgccgggcatcatggccgcggtcgtcgac
gagacgggccaggacgtgccgaacgggcagggcggcattctcgtcgtcaagcgcccgtgg
ccggcgatggcgcgcacgatctggggcgacccggagcgcttcaagaagagctatttcccc
gaggagctcggcggccgcctgtatctggcgggcgacggcaccgtgcgggacaaggaaacc
ggctacttcacgatcatgggccgcatcgacgacgtgctgaacgtatcggggcaccggctc
ggcacgatggagatcgaatcggcgctcgtgtcgcacgagctcgtcgccgaggcggccgtc
gtcggacggccggacgacacgacgggcgaggcggtcgtcgcgttcgtcgtgctcaagcgc
tcgcggccggaaggcgaggaggcggccgcgctcgcgaagacgctgcgcgactgggtcggc
aaggagatcgggccgatcgcgaagccgaaggacatccgtttcggcgataacctgccgaag
acgcgttcgggcaagatcatgcggcgcctgctgcgctcgctcgcgaagggcgaggcgatc
acgcaggatacgtcgacgctcgagaaccccgcgatcctcgaacagctcgccgaagtgcgc
tga

DBGET integrated database retrieval system