KEGG   Burkholderia pseudomallei BPC006: BPC006_II0689Help
Entry
BPC006_II0689     CDS       T02301                                 

Definition
agmatinase
Orthology
K01480  
agmatinase [EC:3.5.3.11]
Organism
bpq  Burkholderia pseudomallei BPC006
Pathway
Arginine and proline metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:bpq00001]
 Metabolism
  Amino acid metabolism
   00330 Arginine and proline metabolism
    BPC006_II0689
Enzymes [BR:bpq01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.3  In linear amidines
    3.5.3.11  agmatinase
     BPC006_II0689
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
II:681021..681983
Genome map
AA seq 320 aa AA seqDB search
MNETLYGDGAIRRPSIYGSSVENTYAGVLSFMRRNYTRDLGGVDVAVCGVPLDLATTFRS
GARLGPAAVRAASVQLAELRPYPWGFDPFDDLAVIDYGDCWFDAHNPLSIKPAIVEHART
ILQSGAAMLTLGGDHYITYPLLIAHAQRHGKPLSLIHFDAHCDTWADDAPDSLNHGTMFY
KAVNEGLIDPKTSVQVGIRTWNDDYLGIHVLDAAWVHEHGPRATAERIASIVGGRPAYLT
FDIDCLDPAFAPGTGTPVAGGLSSAQALAIVRGLGGVNLIGADVVEVAPAYDQSEITAIA
AAHVACDLLCLWRQRKTGAR
NT seq 963 nt NT seq  +upstreamnt  +downstreamnt
atgaatgaaacgctctacggcgacggcgcgatccgccgcccttccatctacggttcctcg
gtcgaaaacacttacgcgggcgtgctgtcgttcatgcggcgcaactacacgcgcgatctc
ggcggtgtcgacgtcgccgtctgcggcgtgccgctcgatctcgcgacgacgttccgctcc
ggcgcgcgcctgggccccgcggcggtacgcgcggcgagtgtgcagcttgccgaactgcgc
ccgtacccttgggggttcgatccgttcgacgatctcgcggtgatcgactatggcgactgc
tggttcgacgcgcacaatccgctgtcgatcaagcccgcgatcgtcgagcacgcgcgcacg
atcctgcaatcgggcgcggcgatgctgacgttgggcggcgatcactacatcacgtatccg
ctgctgatcgcgcacgcacagcggcacggcaagccgctgtcgctgattcacttcgacgcg
cattgcgacacctgggccgacgacgcgcccgacagcctcaatcacggcacgatgttctac
aaggcggtcaacgaagggctgatcgatccgaagacgtcggtgcaggtcggcatccgtacg
tggaacgacgattacctcggcatccacgtgctcgacgccgcctgggtgcacgagcatggg
ccgcgcgcgacggccgagcgcatcgcgtcgatcgtcggcggccggccggcgtatctgacg
ttcgacatcgattgcctcgatcccgcgttcgcgccgggcacgggcacgccggtcgcgggc
gggctgtcgtccgcgcaggcgctcgcgatcgtgcgcggcctcggcggcgtgaacctgatc
ggtgcggacgtcgtcgaagtcgcgcccgcgtatgaccagagcgagatcaccgcgatcgcc
gccgcgcacgtcgcgtgcgatctgctgtgcctgtggcggcagcgcaagacgggcgcgcgc
tga

DBGET integrated database retrieval system