KEGG   Burkholderia pseudomallei BPC006: BPC006_II0783Help
Entry
BPC006_II0783     CDS       T02301                                 

Definition
glutathione-independent formaldehyde dehydrogenase
Orthology
K00148  
glutathione-independent formaldehyde dehydrogenase [EC:1.2.1.46]
Organism
bpq  Burkholderia pseudomallei BPC006
Pathway
Chloroalkane and chloroalkene degradation
Methane metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Carbon metabolism
Class
Metabolism; Overview; Carbon metabolism [PATH:bpq01200]
Metabolism; Energy metabolism; Methane metabolism [PATH:bpq00680]
Metabolism; Xenobiotics biodegradation and metabolism; Chloroalkane and chloroalkene degradation [PATH:bpq00625]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
II:781426..782685
Genome map
AA seq 419 aa AA seqDB search
MSARGRATRGAPPTRHGDEAMSSNRGVVYQGPGKVEVRKIDYPKMVDPSGRAIGHGVILK
VVSTNICGSDQHMVRGRTTAPVGLVLGHEITGEVIEVGRDVETLKIGDLVSVPFNVACGR
CAMCKEQHTGVCLNVNPARAGGAYGYVDMGGWIGGQAEYVLVPYADFNLLKFPDRDRAMA
KIRDLTCLSDILPTGYHGAVTAGVKPGSTVYVAGAGPVGMAAAASARLLGAACTIVGDMN
AERLAHAKAMGFEVIDLSKDATLGEQIEQILGKPEIDCAVDCVGFEAHGHGSSGHAQEAP
ATVLNSLMEITRPAGAIGIPGLYVTDDPGAVDVAAKHGSLSIRFGLGWAKSHSFHTGQTP
VLKYSRNLMQAILFDRLPIAEIVNVAVISLDDAPEGYKKFDGGAPRKFVIDPHGMLKAA
NT seq 1260 nt NT seq  +upstreamnt  +downstreamnt
gtgagcgcgcgcggccgggcgacgcgcggcgcaccgccaacgagacatggagacgaagcg
atgagcagcaaccgaggtgtcgtgtatcaggggccgggcaaggtcgaagtgcggaagatc
gactatccgaagatggtcgatccgagcggccgtgcgatcggccacggcgtgatcctgaag
gtcgtcagcacgaatatctgcggctccgatcagcacatggtgcgcggccgcacgacggcg
cccgtcggtctcgtgctcggccacgagatcacgggcgaggtgatcgaggtcggccgcgat
gtcgagacgctgaagatcggcgatctcgtatcggtgccgttcaacgtcgcgtgcggccgc
tgcgcgatgtgcaaggagcagcacacgggcgtgtgcctgaacgtgaatccggcgcgcgcg
ggcggcgcgtacggctatgtcgacatgggcggctggatcggcgggcaagccgaatacgtg
ctcgtgccgtacgccgacttcaacctgctgaaattccccgatcgcgatcgggccatggcg
aagatccgcgatctcacgtgcctgtcggacattctgccgaccggctatcacggcgcggtc
acggccggcgtgaagcccggctcgacggtttacgtcgcgggcgcgggcccggtggggatg
gcggccgccgcgtcggcgcggctgctcggcgccgcatgcacgatcgtcggcgacatgaac
gccgagcgcctcgcgcacgcgaaggcgatgggcttcgaggtgatcgatctgtcgaaggac
gcgacgctcggcgagcagatcgagcaaatcctcggcaagccggagatcgattgcgcggtt
gactgcgtcggcttcgaggcgcacggccacggctcgtccggccatgcgcaggaggcgccc
gcgacggtgctgaactcgctgatggaaatcacccggcccgcgggcgcgatcggcattccg
ggcctgtacgtgaccgacgatccgggcgccgtcgatgtcgctgccaagcacggcagcctg
agcattcgtttcggtctcggttgggcgaaatcgcattcgttccataccggccagacgccc
gtgctcaagtacagccgcaacctgatgcaggcgatcctgttcgaccggctgccgatcgcg
gaaatcgtcaacgtggcggtgatttcgctcgacgacgcgccggagggctacaagaagttc
gacggcggcgcgccgcgcaaattcgtcatcgatccgcacgggatgctgaaggcggcctga

DBGET integrated database retrieval system