KEGG   Burkholderia pseudomallei BPC006: BPC006_II1003Help
Entry
BPC006_II1003     CDS       T02301                                 

Definition
thermostable monoacylglycerol lipase
Orthology
K03928  
carboxylesterase [EC:3.1.1.1]
Organism
bpq  Burkholderia pseudomallei BPC006
Brite
Enzymes [BR:bpq01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.1  carboxylesterase
     BPC006_II1003
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
II:complement(998485..999306)
Genome map
AA seq 273 aa AA seqDB search
MTGRTGILLIHGLGGTQYDLGSLHKAMRRAGGDTHMITLPGHGTRPEDLVDVRAEAWLDA
VTAQYRALEREYDTVHVAGMCMGALVALLLCRRVRHARGRLALLAAPMFIDGWSTPWYRS
LRHLLYRVPGVPARLRVDEDEPFGIKNPTIRAIVKKKFERQDNFHYPWVPLACIRQVDRL
RSWARAAAADTHCPTLVLHAREDELTSLRSADFLLKHLPDARGIVLENSYHMICADNDRD
EVARQVLTFFGFDPSHAMSPAMARRMGRADPRA
NT seq 822 nt NT seq  +upstreamnt  +downstreamnt
atgaccggccgaacgggcattctgctgatccacgggctcggcgggacgcagtacgatctc
ggctcgctgcacaaggcgatgcgccgggcgggcggcgacacgcacatgatcacgctgccg
gggcacggcacgcgccccgaggatctcgtcgacgtgcgcgcggaagcgtggctcgacgcg
gtcaccgcgcagtatcgcgcgctcgagcgcgagtacgacaccgtgcatgtcgcgggcatg
tgcatgggcgcgctcgtcgcgctgctgctgtgccggcgcgtgcggcacgcgcgcgggcgg
ctcgcgctgttggccgcgccgatgttcatcgacggctggtcgacgccctggtaccgatcg
ctgcgacatctgctgtaccgcgtgcccggcgtgccggcgcggctgcgcgtcgacgaggac
gagccgttcggcatcaagaacccgacgattcgcgcgatcgtgaagaagaagttcgagcgt
caggacaacttccactatccgtgggtgccgcttgcatgcatccgccaggtcgatcgcctg
cgaagctgggcgcgcgcggcggcggccgacacgcactgcccgacgctcgtgctgcatgcg
cgcgaggacgagctcacgagcctgcgctcggcggacttcctgctgaagcacctgcccgac
gcgcgcgggatcgtgctggagaacagctaccacatgatctgcgcggacaacgatcgcgac
gaagtcgcccggcaggtgctgacgtttttcggcttcgatccgtcgcatgcgatgagcccg
gcgatggcgcgccggatggggcgcgccgatccgcgagcgtga

  All links  
No link information was found.   
DBGET integrated database retrieval system