KEGG   Burkholderia pseudomallei BPC006: BPC006_II1587Help
Entry
BPC006_II1587     CDS       T02301                                 

Definition
(RefSeq) ACC deaminase/D-cysteine desulfhydrase family protein
  KO
K05396  
D-cysteine desulfhydrase [EC:4.4.1.15]
Organism
bpq  Burkholderia pseudomallei BPC006
Pathway
Cysteine and methionine metabolism
Brite
KEGG Orthology (KO) [BR:bpq00001]
 Metabolism
  Amino acid metabolism
   00270 Cysteine and methionine metabolism
    BPC006_II1587
Enzymes [BR:bpq01000]
 4. Lyases
  4.4  Carbon-sulfur lyases
   4.4.1  Carbon-sulfur lyases (only sub-subclass identified to date)
    4.4.1.15  D-cysteine desulfhydrase
     BPC006_II1587
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
NCBI-GI: 
NCBI-GeneID: 
Position
II:complement(1599956..1601020)
Genome map
AA seq 354 aa AA seqDB search
MSRTRLLSELVPGLDTLVRPLDLLARPTPVTEEPELARRWGQAGLWIKRDDLANPLYGGS
KVRTLEFFLGRARAQRADGIVTMGPYGSHQLLATAVFGRRTGFLTRGVATPQPDVPEIAL
NRRLLPAYGMEVMRCASFAAVPAALLRARLKPLGAGRPFWIPPGANHPLGVMGVVEGALE
VAQAIRAGSLPVPDDVVVPTGTCATAAGVYLGFALAGLDVRVVAVRMVPMIVTGPAKLLR
MARQTERLLRRYGLTAPARWGELLWTNDHAGPSYGRAGLVAERARADVAQFGAFRTETTY
TAKTLALLAGGGLQRRRVLFWNTYSAIDPDPSRDAGGACAWPDGEPSVHSATAP
NT seq 1065 nt NT seq  +upstreamnt  +downstreamnt
atgagccgcacacgcctgctttccgaactggttcccgggctcgacacgctcgtcaggccg
ctcgatctgctcgcgcggcccacgccggtgaccgaggagccggagctcgcgcgtcgctgg
gggcaggccggcctgtggatcaagcgcgacgatctcgcgaatccgctctacggcggcagc
aaggtccgcacgctcgagttcttcctcggccgcgcgcgcgcgcaacgcgcggacggcatc
gtcacgatggggccctatggcagtcatcagttgctcgcgaccgcggtgttcggccggcgg
accggttttctcacgcgcggcgtcgcgacgccgcagcccgacgtgccggagatcgcgctg
aaccgccggctgctgcccgcgtacggaatggaggtgatgcgctgcgcgagcttcgccgcg
gtgcccgccgcgctgctgcgcgcgcggctcaagccgctcggcgccgggcggccgttctgg
attccgcccggcgcgaatcacccgctcggcgtgatgggcgtcgtcgagggcgcgctcgaa
gtcgcgcaggcgatccgcgcgggcagcctgccggttccggacgacgtcgtcgtgcccacc
ggcacctgcgcgacggcggcgggcgtctacctgggcttcgcgctcgccgggctcgacgtg
cgggtcgtcgcggtgcggatggtgccgatgatcgtcaccgggccggcgaagctgctgcgc
atggcccggcagaccgagcggctgctgcgccgctacggcctgacggcgcccgcgcgctgg
ggcgagctgctgtggaccaacgatcatgcggggccgagctatgggcgcgccggcctcgtc
gccgagcgcgcgcgcgccgacgtcgcgcaattcggcgcgttccgcaccgagaccacctac
accgcgaagacgctcgcgctgctcgcgggcggcggcctgcagcggcggcgggtgctgttc
tggaacacctacagcgcgatcgaccccgacccgtcgcgcgatgccggcggcgcatgcgcg
tggcccgacggcgagccctctgtccattccgcaaccgcaccgtag

DBGET integrated database retrieval system