KEGG   Burkholderia pseudomallei BPC006: BPC006_II1587Help
Entry
BPC006_II1587     CDS       T02301                                 

Definition
ACC deaminase/D-cysteine desulfhydrase family protein
Organism
bpq  Burkholderia pseudomallei BPC006
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
II:complement(1599956..1601020)
Genome map
AA seq 354 aa AA seqDB search
MSRTRLLSELVPGLDTLVRPLDLLARPTPVTEEPELARRWGQAGLWIKRDDLANPLYGGS
KVRTLEFFLGRARAQRADGIVTMGPYGSHQLLATAVFGRRTGFLTRGVATPQPDVPEIAL
NRRLLPAYGMEVMRCASFAAVPAALLRARLKPLGAGRPFWIPPGANHPLGVMGVVEGALE
VAQAIRAGSLPVPDDVVVPTGTCATAAGVYLGFALAGLDVRVVAVRMVPMIVTGPAKLLR
MARQTERLLRRYGLTAPARWGELLWTNDHAGPSYGRAGLVAERARADVAQFGAFRTETTY
TAKTLALLAGGGLQRRRVLFWNTYSAIDPDPSRDAGGACAWPDGEPSVHSATAP
NT seq 1065 nt NT seq  +upstreamnt  +downstreamnt
atgagccgcacacgcctgctttccgaactggttcccgggctcgacacgctcgtcaggccg
ctcgatctgctcgcgcggcccacgccggtgaccgaggagccggagctcgcgcgtcgctgg
gggcaggccggcctgtggatcaagcgcgacgatctcgcgaatccgctctacggcggcagc
aaggtccgcacgctcgagttcttcctcggccgcgcgcgcgcgcaacgcgcggacggcatc
gtcacgatggggccctatggcagtcatcagttgctcgcgaccgcggtgttcggccggcgg
accggttttctcacgcgcggcgtcgcgacgccgcagcccgacgtgccggagatcgcgctg
aaccgccggctgctgcccgcgtacggaatggaggtgatgcgctgcgcgagcttcgccgcg
gtgcccgccgcgctgctgcgcgcgcggctcaagccgctcggcgccgggcggccgttctgg
attccgcccggcgcgaatcacccgctcggcgtgatgggcgtcgtcgagggcgcgctcgaa
gtcgcgcaggcgatccgcgcgggcagcctgccggttccggacgacgtcgtcgtgcccacc
ggcacctgcgcgacggcggcgggcgtctacctgggcttcgcgctcgccgggctcgacgtg
cgggtcgtcgcggtgcggatggtgccgatgatcgtcaccgggccggcgaagctgctgcgc
atggcccggcagaccgagcggctgctgcgccgctacggcctgacggcgcccgcgcgctgg
ggcgagctgctgtggaccaacgatcatgcggggccgagctatgggcgcgccggcctcgtc
gccgagcgcgcgcgcgccgacgtcgcgcaattcggcgcgttccgcaccgagaccacctac
accgcgaagacgctcgcgctgctcgcgggcggcggcctgcagcggcggcgggtgctgttc
tggaacacctacagcgcgatcgaccccgacccgtcgcgcgatgccggcggcgcatgcgcg
tggcccgacggcgagccctctgtccattccgcaaccgcaccgtag

DBGET integrated database retrieval system