KEGG   Burkholderia pseudomallei BPC006: BPC006_II1710Help
Entry
BPC006_II1710     CDS       T02301                                 

Definition
(GenBank) putative oxidoreductase
  KO
K00231  protoporphyrinogen/coproporphyrinogen III oxidase [EC:1.3.3.4 1.3.3.15]
Organism
bpq  Burkholderia pseudomallei BPC006
Pathway
bpq00860  Porphyrin and chlorophyll metabolism
bpq01100  Metabolic pathways
bpq01110  Biosynthesis of secondary metabolites
Module
bpq_M00121  Heme biosynthesis, glutamate => heme
Brite
KEGG Orthology (KO) [BR:bpq00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    BPC006_II1710
Enzymes [BR:bpq01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.3  With oxygen as acceptor
    1.3.3.4  protoporphyrinogen oxidase
     BPC006_II1710
    1.3.3.15  coproporphyrinogen III oxidase (coproporphyrin-forming)
     BPC006_II1710
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Amino_oxidase NAD_binding_8 FAD_binding_2 Pyr_redox_2 FAD_binding_3 DAO HI0933_like AlaDh_PNT_C Pyr_redox FAD_oxidored GIDA Thi4 ApbA Pyr_redox_3 NAD_binding_7 TrkA_N Trp_halogenase Lycopene_cycl MCRA
Motif
Other DBs
NCBI-ProteinID: AFR19637
Position
II:complement(1754272..1755618)
Genome map
AA seq 448 aa AA seqDB search
MAAIVRPRSTLVAALAMHVLVVGAGIAGLAAAWQLKRGGCDVTVVEAAERAGGRIRSAPF
HGHVIECGAQFPSSGYRHLMPLFGEAGLDAQLVKTSPWAAFEHRGRLFRVHARRPWTIPA
SGLLGWRDSVRVSRARAALLARVRALDPNRYAAFAEFDDADAAHWAERAFGRAAVDAIFA
PMIHGLYFQPLRGASRALLAAVTGFDGADTLAVAGGWQTLPVALAARLDVRYGTRVDALS
AHANGVDACVGDRALRFDAAIVATPATVARRLWRGQTDAQRALLATGYARCAHVAFGLAP
GWRAPARLRRVYGALLSPHARRVAALTFERGRGIGDGQGEVVSAMLGHAGASALRYASDD
EIARVALDDLRTLLPGVAEAVVATRVQRWDEAEPLSPVGRARAIAAYRASIDARPRVLLA
GDYMGSPWTDGAAETGRWAARRLLDARA
NT seq 1347 nt NT seq  +upstreamnt  +downstreamnt
gtggcggctattgtacggcctcgttcaaccctcgtcgccgcgctcgccatgcatgtactc
gtcgtcggagcaggaatcgccgggctcgccgccgcctggcaattgaaacggggcggatgc
gacgtgaccgtcgtcgaggccgccgaacgcgcgggcggccgcattcgcagcgcgccgttc
cacggccatgtgatcgaatgcggcgcgcagtttccgtcctccggctatcggcacttgatg
ccgctcttcggcgaggcggggctcgatgcgcaactcgtgaagacctcgccgtgggcggcg
ttcgagcatcgcgggcggctctttcgcgtgcatgcgcggcggccgtggacgatccccgcg
agcggcctgctcggctggcgcgacagcgtgcgcgtgagccgggcgcgcgccgcgctgctc
gcgcgggttcgcgcgctcgatccgaaccgctatgcggcgttcgcggaattcgacgacgcc
gacgcagcccactgggcggaacgcgcgttcgggcgcgcggcggtcgacgcgatcttcgcg
ccgatgattcacgggctgtatttccagccgctgcgcggcgcgtcgcgcgcgctgctcgcg
gccgtcaccggcttcgacggcgcggatacgctcgcggtcgcgggcggctggcagacgctg
cccgtcgcgctcgcggcccggctcgacgtgcgctacggcacgcgggtcgatgcgctgtcg
gcgcacgcgaacggcgtcgacgcgtgcgtcggcgatcgcgcgctgcgtttcgacgcggcg
atcgtcgcgacgcccgcgaccgtcgcgcgccgcctctggcgcgggcagaccgacgcgcag
cgcgcgctgctcgcgacgggctatgcacgctgcgcgcacgtcgcgttcggcctcgcgccg
ggctggcgcgcgcctgcgcggctgcgccgcgtgtacggcgcgctgctgtcgccgcacgcg
cgacgcgtcgcggcgctcacgttcgagcgcgggcgcgggatcggcgacgggcagggcgag
gtcgtatcggcgatgctcgggcatgcgggcgcgagcgcgctgcgctatgcatcggacgac
gagatcgcgcgcgtcgcgctcgacgacctgcgcacgctgttgccgggcgtcgccgaggcg
gtcgtcgcgacgcgcgtgcagcgctgggacgaggccgagccgctgtcgcccgtcggccgc
gcgcgcgcgatcgccgcataccgcgcgagcatcgacgcgcgcccgcgcgtgctgctcgcg
ggcgactacatgggctcgccgtggaccgacggcgcggcggagacgggcagatgggcggcg
cgcaggctgctcgacgcgcgcgcatga

DBGET integrated database retrieval system