KEGG   Burkholderia pseudomallei BPC006: BPC006_II2125Help
Entry
BPC006_II2125     CDS       T02301                                 

Definition
endo-1,4-D-glucanase
Orthology
K01179  
endoglucanase [EC:3.2.1.4]
Organism
bpq  Burkholderia pseudomallei BPC006
Pathway
Starch and sucrose metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:bpq00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    BPC006_II2125
Enzymes [BR:bpq01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.4  cellulase
     BPC006_II2125
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
II:complement(2156897..2158459)
Genome map
AA seq 520 aa AA seqDB search
MARQAGRDEGVGRIGRIGRIGRIGRIGREAGDAREAAGAGEACGRRHARADAWARRASRA
SRGWRTFWRGGGRGRVRAVVASVVASFSVMAFAAATLPVSWRVAAAAERTRSGGERAGGL
RDTAGLIEISAAAPASTPIPAAPRRFAQPFAQPARAFAVASACAPSWPRWDRFKRDFVSA
DGRVIDVGSADERTVSEGQAYGLFFALVANDRAAFDALLRWTEDNLAQGDLSARLPAWLW
GRAADGAWRVLDANAASDADLWLAYALLEAGRLWRERSYTARGALLAKRVLDEETATLPG
LGLVLLPGPTGFRPARDAWRLNPSYSPPQAIRGIGAHVPDDARWARLAAGVGRVLTDSAP
RGFAPDWALYRAGRGFEPDAETHAASAYNAIRVYLWAGMLDAGDPLARPLVAHFAPFAEH
VAAHGAPPEAVDATTGAAAPRDGNAGFSAAAVPFLEARGERASADAQLARVARLERETAS
GYYANVLTLFGLGWRDGRYRFAADGTLRVRWSEPCSTPAR
NT seq 1563 nt NT seq  +upstreamnt  +downstreamnt
atggcgcggcaagcggggcgagacgaaggcgtcgggcgcatcgggcgcatcgggcgcatc
gggcgcatcgggcgcatcgggcgtgaagcgggcgacgcgcgcgaggcggccggggcgggc
gaggcgtgcgggaggcgccacgcgcgggccgacgcgtgggcgcggcgggcgtcgcgagca
tcgcgcgggtggcgcacgttttggcgcgggggcgggcgtgggcgcgtgcgcgccgtcgtg
gcgagcgtcgtggcgagcttctcggtgatggcgttcgcggcggcgacgttgccggtgtcg
tggcgcgtcgccgcggcggcggagcgtacgcgaagcggcggcgaacgcgcgggcgggctg
cgcgacacggcgggcttgatcgagatctcggcggcggcgccggcctcgacgccgatcccg
gcggcgccgcggcggttcgcgcagccgttcgcgcagccggctcgcgcgttcgccgtcgcg
agcgcctgcgcgccgtcctggccgcgctgggaccgtttcaagcgtgacttcgtatcggcc
gacggccgcgtgatcgacgtcggctcggccgacgagcggaccgtatccgaggggcaggcg
tacggccttttcttcgcgctcgtcgcgaacgaccgcgcggcgttcgacgcgctgctgcgc
tggaccgaggacaatctcgcgcagggcgatctgagcgcgcgtctgcccgcgtggctgtgg
ggccgcgcggccgacggcgcgtggcgcgtgctcgatgcgaacgccgcgtccgacgccgat
ctgtggcttgcgtacgcgctgctcgaagcggggcgcttgtggcgcgagcgcagctacacg
gcgcgcggcgcgttgctcgcgaagcgcgtgctcgacgaggagaccgcgacgctgccgggg
ctcggtctcgtgctgctgccgggcccgacgggttttcggccggcgcgcgacgcgtggcgg
ctgaatccgagctattcgccgccgcaggcgattcgcgggatcggcgcgcatgtgcccgac
gacgcgcgctgggcgcggctcgcggcgggcgtcggccgcgtgctgaccgacagcgcgccg
cgcggcttcgcgccggactgggcgctgtatcgcgcgggccgcggcttcgagccggacgcc
gaaacgcatgcggcgagcgcgtacaacgcgattcgcgtctatctgtgggcgggcatgctc
gatgcgggcgacccgttggcgcggccgctcgtcgcgcatttcgcgccgttcgccgagcat
gtcgccgcgcatggcgcgccgccggaggcggtcgatgcgacgacgggcgcggccgccccg
cgcgacggcaatgccgggttttccgcggcggccgtgccgtttctcgaggcgcgcggcgag
cgggcgagcgccgacgcgcagctcgcgcgcgtcgcgcggctcgagcgcgagacggcgagc
ggctattacgcgaacgtgctgacgctgttcgggctcggctggcgcgacgggcgctaccgg
ttcgcggccgacggcacgctgcgggtgcgatggagcgagccgtgctcgacgcccgcgcgt
tga

DBGET integrated database retrieval system