KEGG   Burkholderia pseudomallei BPC006: BPC006_II2136Help
Entry
BPC006_II2136     CDS       T02301                                 

Definition
agmatinase
Orthology
K12255  
guanidinobutyrase [EC:3.5.3.7]
Organism
bpq  Burkholderia pseudomallei BPC006
Pathway
Arginine and proline metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:bpq00001]
 Metabolism
  Amino acid metabolism
   00330 Arginine and proline metabolism
    BPC006_II2136
Enzymes [BR:bpq01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.3  In linear amidines
    3.5.3.7  guanidinobutyrase
     BPC006_II2136
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
II:2165800..2166753
Genome map
AA seq 317 aa AA seqDB search
MSDDYFQPQSGNAMPRFAGIATMMRLPQAASAAGLDACFVGVPFDLGTSNRTGARFGPRQ
IRSESVLLRPYNMATRAAPFDSLRVADLGDVATNPYNLADSIARIEAAYHAILAHGCRPV
TLGGDHTITLPILRAMHRRHGRVGLIHVDAHADVNDTMFGEKIAHGTPFRRALEEGLLDG
DRVVQIGLRGTGYAAEDFDWCRDQGFRVVQAEACWNRSLAPLMDEVRARVQGGPVYLSFD
IDGIDPAYAPGTGTPEIAGLTVPQGLEIVRGAWGLDIVGADLVEVAPPYDPFGTTALLGA
NLAYEMLCVLPGVARRA
NT seq 954 nt NT seq  +upstreamnt  +downstreamnt
atgtcggatgattacttccagccgcaaagcggcaacgcgatgccgcgcttcgccggcatc
gcgacgatgatgcggctgccgcaggcggcgagcgccgcggggctcgacgcgtgctttgtc
ggcgtgccgttcgatctcggcacgtcgaaccgcaccggcgcgcggttcggcccgcgccag
atccgcagcgaatccgtgctgctgcgcccgtacaacatggccacgcgcgcggcgccgttc
gattcgctgcgcgtcgccgatctcggcgacgtcgcgacgaacccgtacaacctcgccgat
tcgatcgcgcggatcgaggccgcgtaccacgcgatcctcgcgcacggctgccgcccggtc
acgctcggcggcgaccacacgatcacgctgccgatcctgcgcgcgatgcatcgccggcac
gggcgcgtcgggctcatccatgtcgacgcgcacgcggacgtcaacgacacgatgttcggc
gagaagatcgcgcacggcacgccgtttcgccgcgcgctcgaggaagggctgctcgacggc
gaccgcgtcgtgcagatcggcctgcgcggcaccggctatgcggccgaggatttcgactgg
tgccgcgatcagggctttcgcgtcgtccaggccgaggcgtgctggaaccgctcgctcgcg
ccgctgatggacgaagtgcgcgcgcgcgtgcaaggcggcccggtctatctgagcttcgac
atcgacggcatcgatccggcgtacgcgccgggcaccggcacgccggagatcgccggcctc
acggtgccgcagggcctcgagatcgtgcgcggcgcgtgggggctcgacatcgtcggcgcc
gatctcgtcgaggtcgcgccgccgtacgatccgttcggcaccaccgcgctgctcggcgcg
aacctcgcttacgagatgctctgcgtgctgcccggcgtggcgcggcgcgcgtga

DBGET integrated database retrieval system