KEGG   Burkholderia pseudomallei BPC006: BPC006_II2279Help
Entry
BPC006_II2279     CDS       T02301                                 

Definition
(GenBank) tryptophan synthase subunit alpha
  KO
K01695  tryptophan synthase alpha chain [EC:4.2.1.20]
Organism
bpq  Burkholderia pseudomallei BPC006
Pathway
bpq00260  Glycine, serine and threonine metabolism
bpq00400  Phenylalanine, tyrosine and tryptophan biosynthesis
bpq01100  Metabolic pathways
bpq01110  Biosynthesis of secondary metabolites
bpq01130  Biosynthesis of antibiotics
bpq01230  Biosynthesis of amino acids
Module
bpq_M00023  Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:bpq00001]
 Metabolism
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    BPC006_II2279
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    BPC006_II2279
Enzymes [BR:bpq01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     BPC006_II2279
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Trp_syntA PcrB Peripla_BP_6 His_biosynth B12-binding BtpA Amidohydro_2
Motif
Other DBs
NCBI-ProteinID: AFR20205
Position
II:complement(2338427..2339242)
Genome map
AA seq 271 aa AA seqDB search
MSRIQNTFAALAAQGRKGLIPFITAGDPDPAKTVELMHALAEGGADVIELGVPFSDPMAD
GPVIQRSSERALAKGVTLHSVLDDVKRFRARDQKTPVVLMGYANPIERMGADAFAAAARD
AGVDGVLVVDYPPEESHDFAAKMRAAGIDPIFLLAPTSTDDRIAAVGQVASGYVYYVSLK
GVTGAANLDVSSIAGKIPAIKSRVPLPVGVGFGIRDAATARAVAEVADAVVIGSRLVQLL
EQAAPERAAAELAGFVAELRAAIDGAAKPAA
NT seq 816 nt NT seq  +upstreamnt  +downstreamnt
atgtcccgtattcagaacacttttgccgcactcgccgcccaaggtcgcaaggggctgatt
ccgttcatcaccgcgggagacccggacccggcgaagaccgtcgagctgatgcacgcgctc
gccgaaggcggcgccgacgtgatcgagctcggcgtgccgttctccgacccgatggccgac
ggccccgtgatccagcgctcgtcggagcgcgcgctcgcgaaaggcgtgacgcttcacagc
gtgctcgacgacgtgaagcgctttcgcgcgcgcgaccagaagacgcccgtcgtgctgatg
ggctacgcgaatccgatcgagcgcatgggcgcggacgcattcgccgcggccgcgcgcgac
gcgggcgtcgacggcgtgctcgtcgtcgactatccgcccgaggaatcgcacgatttcgcc
gcgaagatgcgcgcggcgggcatcgatccgatcttcctgctcgcgccgacgtcgaccgac
gaccggatcgccgccgtcggccaggtggcgagcggctacgtctactatgtgtcgctcaag
ggggtgacgggcgccgcaaatctggatgtttccagcattgcgggtaaaatcccggccatc
aagtcgcgcgtgccgcttcccgtcggggtcggtttcggcatccgcgacgccgcgacggcg
cgcgcggtggccgaggtggcggacgccgtcgtgatcggcagccgccttgtccagctgctg
gagcaggccgcgccggagcgggccgccgccgagctcgcggggttcgtcgccgagctgcgc
gccgcgatcgacggcgcggcgaagccggcggcatga

DBGET integrated database retrieval system