KEGG   Burkholderia pseudomallei BPC006: BPC006_II2306Help
Entry
BPC006_II2306     CDS       T02301                                 

Definition
(GenBank) succinate dehydrogenase, hydrophobic membrane anchor subunit
  KO
K00242  succinate dehydrogenase / fumarate reductase, membrane anchor subunit
Organism
bpq  Burkholderia pseudomallei BPC006
Pathway
bpq00020  Citrate cycle (TCA cycle)
bpq00190  Oxidative phosphorylation
bpq00650  Butanoate metabolism
bpq01100  Metabolic pathways
bpq01110  Biosynthesis of secondary metabolites
bpq01120  Microbial metabolism in diverse environments
bpq01130  Biosynthesis of antibiotics
bpq01200  Carbon metabolism
Module
bpq_M00009  Citrate cycle (TCA cycle, Krebs cycle)
bpq_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
bpq_M00149  Succinate dehydrogenase, prokaryotes
Brite
KEGG Orthology (KO) [BR:bpq00001]
 Metabolism
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    BPC006_II2306
   00650 Butanoate metabolism
    BPC006_II2306
  Energy metabolism
   00190 Oxidative phosphorylation
    BPC006_II2306
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Sdh_cyt
Motif
Other DBs
NCBI-ProteinID: AFR20232
Position
II:complement(2365433..2365801)
Genome map
AA seq 122 aa AA seqDB search
MAANNRIGSKRLVVGAHYGLRDWLAQRVTASVMAIYTVILLVWFFIARDFSYEGWASIFA
TQWMKLATFVTLLSLFYHAWVGVRDIWMDYIKPVGVRLLLQSLTIVWLLACAGYAAQILW
RV
NT seq 369 nt NT seq  +upstreamnt  +downstreamnt
atggcagcgaataaccgtatcggctcgaagcgcctcgtcgtcggcgcacactatggtctg
cgcgactggctggcgcagcgcgtcaccgcgagcgtgatggcgatctacaccgtcatcctg
ctcgtctggttcttcatcgcgcgcgatttctcgtacgagggctgggcgtcgatcttcgcg
acgcaatggatgaagctcgcgaccttcgtcacgctgctctcgctcttctatcacgcatgg
gtcggcgtgcgcgacatctggatggactacatcaagcccgtcggtgtgcgcctgctgctg
caatcgctgacgatcgtctggctgctcgcgtgcgcgggctacgctgcgcagattctctgg
agagtttaa

DBGET integrated database retrieval system