KEGG   Burkholderia pseudomallei BPC006: BPC006_II2306Help
Entry
BPC006_II2306     CDS       T02301                                 

Definition
succinate dehydrogenase, hydrophobic membrane anchor subunit
Orthology
K00242  
succinate dehydrogenase membrane anchor subunit
Organism
bpq  Burkholderia pseudomallei BPC006
Pathway
Citrate cycle (TCA cycle)
Oxidative phosphorylation
Butanoate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Citrate cycle (TCA cycle, Krebs cycle)
Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Succinate dehydrogenase, prokaryotes
Brite
KEGG Orthology (KO) [BR:bpq00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    BPC006_II2306
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    BPC006_II2306
   00650 Butanoate metabolism
    BPC006_II2306
  Energy metabolism
   00190 Oxidative phosphorylation
    BPC006_II2306
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
II:complement(2365433..2365801)
Genome map
AA seq 122 aa AA seqDB search
MAANNRIGSKRLVVGAHYGLRDWLAQRVTASVMAIYTVILLVWFFIARDFSYEGWASIFA
TQWMKLATFVTLLSLFYHAWVGVRDIWMDYIKPVGVRLLLQSLTIVWLLACAGYAAQILW
RV
NT seq 369 nt NT seq  +upstreamnt  +downstreamnt
atggcagcgaataaccgtatcggctcgaagcgcctcgtcgtcggcgcacactatggtctg
cgcgactggctggcgcagcgcgtcaccgcgagcgtgatggcgatctacaccgtcatcctg
ctcgtctggttcttcatcgcgcgcgatttctcgtacgagggctgggcgtcgatcttcgcg
acgcaatggatgaagctcgcgaccttcgtcacgctgctctcgctcttctatcacgcatgg
gtcggcgtgcgcgacatctggatggactacatcaagcccgtcggtgtgcgcctgctgctg
caatcgctgacgatcgtctggctgctcgcgtgcgcgggctacgctgcgcagattctctgg
agagtttaa

DBGET integrated database retrieval system