KEGG   Burkholderia pseudomallei BPC006: BPC006_II2624Help
Entry
BPC006_II2624     CDS       T02301                                 

Definition
thymidine phosphorylase
Orthology
K00758  
thymidine phosphorylase [EC:2.4.2.4]
Organism
bpq  Burkholderia pseudomallei BPC006
Pathway
Pyrimidine metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:bpq00001]
 Metabolism
  Nucleotide metabolism
   00240 Pyrimidine metabolism
    BPC006_II2624
Enzymes [BR:bpq01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.2  Pentosyltransferases
    2.4.2.4  thymidine phosphorylase
     BPC006_II2624
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
II:complement(2655689..2657011)
Genome map
AA seq 440 aa AA seqDB search
MTFLPQEFIRKVRDRAPLDTADVARFVQGVTAGDVTEGQIAAFAMAVYFNELPLSARIAL
TLAQRDSGDVLDWRGARLNGPVVDKHSTGGVGDLTSLVIGPMVAACGGYVPMISGRGLGH
TGGTLDKLEAIPGYDVAPSVDMLRRVVRDAGLAIVGQTAQLAPADKRIYAVRDVTATVES
ISLITASILSKKLAAGVSALAMDVKVGSGAFMPSAEQSAELARSIVDVGNGAGMRTAATL
TDMNQALAPCAGNAIEVRCAIDFLTGAARPARLEAVSFALAAQMLTMGGLAADAHDARRR
LRAVLESGAAAERFARMVAALGGPADLVERPERHLPRAAAAAPVAAARAGWIERIDARAL
GLAVVGLGGGRAKIGDTLDYSVGLSALAELGERVEAGQPLATVHARDADSAAQATDAVRR
AYRIGAEPPAQTRVVHAVIE
NT seq 1323 nt NT seq  +upstreamnt  +downstreamnt
atgaccttcctgccgcaggaattcatccgcaaggtgcgcgaccgcgcgccgctcgacacg
gccgacgtcgcgcgtttcgtccaaggcgtgacggcgggcgacgtgaccgaaggccagatc
gccgcgttcgcgatggcggtctatttcaacgagttgccgctgtccgcgcgcatcgcgctg
acgctcgcgcagcgcgattccggcgacgtgctcgactggcgcggcgcgcgcctgaacggg
ccggtggtcgacaagcactcgacgggcggcgtcggcgatctgacctcgctcgtgatcggg
ccgatggtggccgcgtgcggcggctacgtgccgatgatctcgggccgcggcctcggccac
acgggcggcacgctcgacaagctcgaggcgattcccggttacgatgtcgcgccgtccgtc
gacatgctgcgccgcgtcgtgcgcgacgcgggccttgcgatcgtcggccagaccgcgcag
ctcgcgcccgccgacaagcggatctatgcggtgcgcgacgtgacggcgaccgtcgaatcg
atctcgctgatcaccgcgtcgatcctgtcgaagaagctcgcggcgggcgtcagcgcgctc
gcgatggacgtgaaggtcggctccggcgcgttcatgccgagcgcggagcaatcggccgaa
ctcgcgcgcagcatcgtcgacgtcggcaacggcgcggggatgaggacggccgcgacgctc
accgacatgaaccaggcgctcgcgccatgcgcgggcaacgcgatcgaggtgcgctgcgcg
atcgatttcctgacgggcgcggcgcgccccgcgcggctcgaagcggtcagcttcgcgctc
gccgcgcagatgctgacgatgggcgggcttgccgcggacgcgcacgatgcgcgccgccgg
ttgcgcgcggtgctcgaatcgggcgcggccgcggagcggttcgcgcggatggtcgcggcg
ctcggcgggcccgccgatctggtcgagcggcccgagcggcatctgccgcgcgcggctgcc
gccgcccccgtggccgccgcgcgcgccggctggatcgagcggatcgacgcgcgcgcgctc
ggcctggcggtcgtcggcctgggcggcgggcgcgcgaagatcggcgacacgctcgattac
tcggtcggactgtccgcgctcgcggagctgggcgagcgcgtcgaggcgggccagccgctc
gcgaccgttcacgcgcgcgacgccgattcggccgcgcaggcgaccgacgcggtgcggcgc
gcctaccggatcggcgcggagccgccggcgcagacgcgcgtcgttcatgccgtgatcgaa
tga

DBGET integrated database retrieval system